RegulonDB RegulonDB 10.8: Gene Form
   

cspC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rlmA cspC yobF mntP Cis-reg; thermoregulator anti-terminator terminator cspCp8 cspCp8 rlmAp9 rlmAp9

Gene      
Name: cspC    Texpresso search in the literature
Synonym(s): ECK1821, EG12204, b1823, msmB
Genome position(nucleotides): 1907226 <-- 1907435 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
46.67
External database links:  
ASAP:
ABE-0006070
CGSC:
35339
ECHOBASE:
EB2120
OU-MICROARRAY:
b1823
PortEco:
cspC
STRING:
511145.b1823
COLOMBOS: cspC


Product      
Name: stress protein, member of the CspA family
Synonym(s): CspC, MsmB
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 7.402
Isoelectric point: 7.541
Motif(s):
 
Type Positions Sequence
5 -> 68 KGQVKWFNESKGFGFITPADGSKDVFVHFSAIQGNGFKTLAEGQNVEFEIQDGQKGPAAVNVTA
2 -> 69 AKIKGQVKWFNESKGFGFITPADGSKDVFVHFSAIQGNGFKTLAEGQNVEFEIQDGQKGPAAVNVTAI
7 -> 7 Q
6 -> 66 GQVKWFNESKGFGFITPADGSKDVFVHFSAIQGNGFKTLAEGQNVEFEIQDGQKGPAAVNV

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level
  5 - cell processes --> 5.5 - adaptations
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003676 - nucleic acid binding
GO:0003677 - DNA binding
GO:0003697 - single-stranded DNA binding
GO:0003723 - RNA binding
GO:0051087 - chaperone binding
GO:0001072 - transcription antitermination factor activity, RNA binding
biological_process GO:0031564 - transcription antitermination
GO:0060567 - negative regulation of DNA-templated transcription, termination
Note(s): Note(s): ...[more].
Evidence: [AIFS] Automated inference of function from sequence
[IE] Inferred from experiment
Reference(s): [1] Perez-Rueda E., et al., 2004
External database links:  
DIP:
DIP-36183N
ECOCYC:
EG12204-MONOMER
ECOLIWIKI:
b1823
INTERPRO:
IPR002059
INTERPRO:
IPR019844
INTERPRO:
IPR012340
INTERPRO:
IPR012156
INTERPRO:
IPR011129
MINT:
MINT-1218847
MODBASE:
P0A9Y6
PFAM:
PF00313
PRIDE:
P0A9Y6
PRINTS:
PR00050
PRODB:
PRO_000022340
PROSITE:
PS51857
PROSITE:
PS00352
REFSEQ:
NP_416337
SMART:
SM00357
SMR:
P0A9Y6
SWISSMODEL:
P0A9Y6
UNIPROT:
P0A9Y6


Operon      
Name: yobF-cspC         
Operon arrangement:
Transcription unit        Promoter
yobF-cspC
yobF-cspC


Transcriptional Regulation      
Display Regulation             
Repressed by: BtsR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter rlmAp9 1907086 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter cspCp8 1907509 reverse Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Perez-Rueda E., Collado-Vides J., Segovia L., 2004, Phylogenetic distribution of DNA-binding transcription factors in bacteria and archaea., Comput Biol Chem 28(5-6):341-50

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB