RegulonDB RegulonDB 10.8: Gene Form
   

rlmA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rlmA mntP yobD cspC Fur MntR MntR Cis-reg; thermoregulator anti-terminator terminator terminator rlmAp9 rlmAp9 TSS_2172 TSS_2172 mntPp mntPp

Gene      
Name: rlmA    Texpresso search in the literature
Synonym(s): ECK1820, EG12207, b1822, rrmA, yebH
Genome position(nucleotides): 1906251 <-- 1907060 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.36
External database links:  
ASAP:
ABE-0006067
ECHOBASE:
EB2122
OU-MICROARRAY:
b1822
PortEco:
rrmA
STRING:
511145.b1822
COLOMBOS: rlmA


Product      
Name: 23S rRNA m1G745 methyltransferase
Synonym(s): RlmA, RrmA, YebH, rRNA large subunit methyltransferase A, ribosomal RNA large subunit methyltransferase A
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 30.419
Isoelectric point: 7.293
Motif(s):
 
Type Positions Sequence
84 -> 196 DKATAVLDIGCGEGYYTHAFADALPEITTFGLDVSKVAIKAAAKRYPQVTFCVASSHRLPFSDTSMDAIIRIYAPCKAEELARVVKPGGWVITATPGPRHLMELKGLIYNEVH
96 -> 97 EG

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.3 - RNA modification
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0008168 - methyltransferase activity
GO:0016740 - transferase activity
GO:0046872 - metal ion binding
GO:0008270 - zinc ion binding
GO:0008989 - rRNA (guanine-N1-)-methyltransferase activity
GO:0052911 - 23S rRNA (guanine(745)-N(1))-methyltransferase activity
biological_process GO:0006364 - rRNA processing
GO:0032259 - methylation
GO:0070475 - rRNA base methylation
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG12207-MONOMER
ECOLIWIKI:
b1822
INTERPRO:
IPR016718
INTERPRO:
IPR029063
INTERPRO:
IPR025714
MODBASE:
P36999
PDB:
1P91
PFAM:
PF13847
PRIDE:
P36999
PRODB:
PRO_000023765
REFSEQ:
NP_416336
SMR:
P36999
UNIPROT:
P36999


Operon      
Name: rlmA         
Operon arrangement:
Transcription unit        Promoter
 


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2172 1905462 forward nd [RS-EPT-CBR] [1]
  promoter rlmAp9 1907086 reverse Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB