RegulonDB RegulonDB 10.8: Gene Form
   

crcB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ybeM crcB tatE cspE3\' cspE Cis-reg; thermoregulator tatEp3 tatEp3 crcBp4 crcBp4 crcBp3 crcBp3 TSS_753 TSS_753 TSS_752 TSS_752

Gene      
Name: crcB    Texpresso search in the literature
Synonym(s): ECK0617, EG12209, b0624, ybeI
Genome position(nucleotides): 657555 <-- 657938 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.44
External database links:  
ASAP:
ABE-0002144
ECHOBASE:
EB2123
OU-MICROARRAY:
b0624
PortEco:
crcB
STRING:
511145.b0624
COLOMBOS: crcB


Product      
Name: F- channel
Synonym(s): CrcB, Fluc-Ec2, YbeI
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 13.777
Isoelectric point: 9.823
Motif(s):
 
Type Positions Sequence
71 -> 91 TGFCGGLTTFSTFSAEVVFLL
35 -> 55 LGTLTANLIGAFIIGIGFAWF
4 -> 24 LLLAVFIGGGTGSVARWLLSM
6 -> 116 LAVFIGGGTGSVARWLLSMRFNPLHQAIPLGTLTANLIGAFIIGIGFAWFSRMTNIDPVWKVLITTGFCGGLTTFSTFSAEVVFLLQEGRFGWALLNVFVNLLGSFAMTAL
103 -> 123 VFVNLLGSFAMTALAFWLFSA

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.6 - protection
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0015103 - inorganic anion transmembrane transporter activity
GO:0005253 - anion channel activity
GO:0042803 - protein homodimerization activity
GO:1903425 - fluoride transmembrane transporter activity
biological_process GO:0140114 - cellular detoxification of fluoride
GO:0034220 - ion transmembrane transport
GO:1903424 - fluoride transmembrane transport
External database links:  
ECOCYC:
EG12209-MONOMER
ECOLIWIKI:
b0624
INTERPRO:
IPR003691
PANTHER:
PTHR28259
PDB:
6BX5
PDB:
6BX4
PFAM:
PF02537
PRIDE:
P37002
PRODB:
PRO_000022328
REFSEQ:
NP_415157
SMR:
P37002
UNIPROT:
P37002


Operon      
Name: crcB         
Operon arrangement:
Transcription unit        Promoter
crcB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_752 657964 forward nd [RS-EPT-CBR] [1]
  promoter TSS_753 657966 forward nd [RS-EPT-CBR] [1]
  promoter crcBp3 657998 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter crcBp4 658008 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter tatEp3 658871 forward Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB