RegulonDB RegulonDB 10.9: Gene Form
   

waaF gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

waaF waaC rfaD TSS_4208 TSS_4208 TSS_4207 TSS_4207 TSS_4206 TSS_4206

Gene      
Name: waaF    Texpresso search in the literature
Synonym(s): ECK3610, EG12210, b3620, rfaF
Genome position(nucleotides): 3794929 --> 3795975 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.68
External database links:  
ASAP:
ABE-0011845
CGSC:
28434
ECHOBASE:
EB2124
ECOLIHUB:
rfaF
NCBI-GENE:
948135
OU-MICROARRAY:
b3620
STRING:
511145.b3620
COLOMBOS: waaF


Product      
Name: ADP-heptose—LPS heptosyltransferase 2
Synonym(s): ADP-heptose:LPS heptosyltransferase II, HepII, RfaF, WaaF
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 39.042
Isoelectric point: 7.614
Motif(s):
 
Type Positions Sequence
19 -> 20 SL
69 -> 324 RRKLGHSLREKRYDRAYVLPNSFKSALVPFFAGIPHRTGWRGEMRYGLLNDVRVLDKEAWPLMVERYIALAYDKGIMRTAQDLPQPLLWPQLQVSEGEKSYTCNQFSLSSERPMIGFCPGAEFGPAKRWPHYHYAELAKQLIDEGYQVVLFGSAKDHEAGNEILAALNTEQQAWCRNLAGETQLDQAVILIAACKAIVTNDSGLMHVAAALNRPLVALYGPSSPDFTPPLSHKARVIRLITGYHKVRKGDAAEGYH
204 -> 205 EL
105 -> 105 R
16 -> 16 M

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.3 - lipopolysaccharide --> 1.6.3.2 - core region
  6 - cell structure --> 6.3 - surface antigens (ECA, O antigen of LPS)
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016757 - transferase activity, transferring glycosyl groups
GO:0016740 - transferase activity
GO:0008713 - ADP-heptose-lipopolysaccharide heptosyltransferase activity
biological_process GO:0009103 - lipopolysaccharide biosynthetic process
GO:0009244 - lipopolysaccharide core region biosynthetic process
Note(s): Note(s): ...[more].
Reference(s): [1] Anthony KG., et al., 1994
[2] Brabetz W., et al., 1997
[3] Coleman WG., et al., 1985
[4] Roncero C., et al., 1992
[5] Schnaitman CA., et al., 1991
External database links:  
CAZY:
GT9
DIP:
DIP-10667N
ECOCYC:
EG12210-MONOMER
ECOLIWIKI:
b3620
INTERPRO:
IPR002201
INTERPRO:
IPR011910
MODBASE:
P37692
PDB:
1PSW
PFAM:
PF01075
PRIDE:
P37692
PRODB:
PRO_000023718
REFSEQ:
NP_418077
SMR:
P37692
UNIPROT:
P37692


Operon      
Name: rfaD-waaFCL         
Operon arrangement:
Transcription unit        Promoter
rfaDFCL
rfaDFCL
rfaDFCL
rfaDFCL


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4206 3794418 forward nd [RS-EPT-CBR] [6]
  promoter TSS_4207 3794433 forward nd [RS-EPT-CBR] [6]
  promoter TSS_4208 3794859 forward nd [RS-EPT-CBR] [6]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Anthony KG., Sherburne C., Sherburne R., Frost LS., 1994, The role of the pilus in recipient cell recognition during bacterial conjugation mediated by F-like plasmids., Mol Microbiol 13(6):939-53

 [2] Brabetz W., Muller-Loennies S., Holst O., Brade H., 1997, Deletion of the heptosyltransferase genes rfaC and rfaF in Escherichia coli K-12 results in an Re-type lipopolysaccharide with a high degree of 2-aminoethanol phosphate substitution., Eur J Biochem 247(2):716-24

 [3] Coleman WG., Deshpande KS., 1985, New cysE-pyrE-linked rfa mutation in Escherichia coli K-12 that results in a heptoseless lipopolysaccharide., J Bacteriol 161(3):1209-14

 [4] Roncero C., Casadaban MJ., 1992, Genetic analysis of the genes involved in synthesis of the lipopolysaccharide core in Escherichia coli K-12: three operons in the rfa locus., J Bacteriol 174(10):3250-60

 [5] Schnaitman CA., Parker CT., Klena JD., Pradel EL., Pearson NB., Sanderson KE., MacClachlan PR., 1991, Physical maps of the rfa loci of Escherichia coli K-12 and Salmonella typhimurium., J Bacteriol 173(23):7410-1

 [6] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB