RegulonDB RegulonDB 10.9: Gene Form
   

arsR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

arsB arsR agrB ArsR arsRp arsRp agrBp agrBp

Gene      
Name: arsR    Texpresso search in the literature
Synonym(s): ECK3486, EG12235, arsE, b3501
Genome position(nucleotides): 3648528 --> 3648881 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.85
External database links:  
ASAP:
ABE-0011435
CGSC:
35993
ECHOBASE:
EB2147
ECOLIHUB:
arsR
OU-MICROARRAY:
b3501
STRING:
511145.b3501
COLOMBOS: arsR


Product      
Name: DNA-binding transcriptional repressor ArsR
Synonym(s): ArsE, ArsR
Sequence: Get amino acid sequence Fasta Format
Regulator Family: ArsR
Cellular location: cytosol
Molecular weight: 13.253
Isoelectric point: 8.126
Motif(s):
 
Type Positions Sequence
1 -> 92 MSFLLPIQLFKILADETRLGIVLLLSELGELCVCDLCTALDQSQPKISRHLALLRESGLLLDRKQGKWVHYRLSPHIPAWAAKIIDEAWRCE
15 -> 60 DETRLGIVLLLSELGELCVCDLCTALDQSQPKISRHLALLRESGLL
33 -> 52 VCDLCTALDQSQPKISRHLA

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.3 - repressor
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.1 - operon
  5 - cell processes --> 5.6 - protection --> 5.6.4 - drug resistance/sensitivity
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0003700 - DNA-binding transcription factor activity
GO:0000976 - transcription regulatory region sequence-specific DNA binding
biological_process GO:0006351 - transcription, DNA-templated
GO:0006355 - regulation of transcription, DNA-templated
GO:0046685 - response to arsenic-containing substance
External database links:  
DIP:
DIP-9163N
ECOCYC:
EG12235-MONOMER
ECOLIWIKI:
b3501
INTERPRO:
IPR001845
INTERPRO:
IPR036390
INTERPRO:
IPR011991
INTERPRO:
IPR018334
INTERPRO:
IPR036388
MODBASE:
P37309
PFAM:
PF01022
PRIDE:
P37309
PRINTS:
PR00778
PRODB:
PRO_000022156
PROSITE:
PS00846
PROSITE:
PS50987
REFSEQ:
NP_417958
SMART:
SM00418
SMR:
P37309
UNIPROT:
P37309


Operon      
Name: arsRBC         
Operon arrangement:
Transcription unit        Promoter
arsRBC


Transcriptional Regulation      
Display Regulation             
Repressed by: ArsR
Growth Conditions:

[1] 

C: Escherichia coli| LB medium| 37.0 C
E: Escherichia coli| LB medium| sodium arsenite 50 µM| 37.0 C



Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB