RegulonDB RegulonDB 10.9: Gene Form
   

arsC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

arsB insH11 arsC

Gene      
Name: arsC    Texpresso search in the literature
Synonym(s): ECK3488, EG12237, arsG, b3503
Genome position(nucleotides): 3650237 --> 3650662 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.88
External database links:  
ASAP:
ABE-0011439
CGSC:
35999
ECHOBASE:
EB2149
ECOLIHUB:
arsC
OU-MICROARRAY:
b3503
STRING:
511145.b3503
COLOMBOS: arsC


Product      
Name: arsenate reductase
Synonym(s): ArsC, ArsG
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 15.853
Isoelectric point: 5.283
Motif(s):
 
Type Positions Sequence
7 -> 115 YHNPACGTSRNTLEMIRNSGTEPTIIHYLETPPTRDELVKLIADMGISVRALLRKNVEPYEELGLAEDKFTDDRLIDFMLQHPILINRPIVVTPLGTRLCRPSEVVLEI

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.6 - protection --> 5.6.2 - detoxification
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016491 - oxidoreductase activity
GO:0008794 - arsenate reductase (glutaredoxin) activity
biological_process GO:0006974 - cellular response to DNA damage stimulus
GO:0046685 - response to arsenic-containing substance
GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
Reference(s): [1] Chaturvedi N., et al., 2014
[2] Kaur S., et al., 2009
External database links:  
ECOCYC:
EG12237-MONOMER
ECOLIWIKI:
b3503
INTERPRO:
IPR036249
INTERPRO:
IPR006660
INTERPRO:
IPR006659
MODBASE:
P0AB96
PFAM:
PF03960
PRIDE:
P0AB96
PRODB:
PRO_000022155
PROSITE:
PS51353
REFSEQ:
NP_417960
SMR:
P0AB96
SWISSMODEL:
P0AB96
UNIPROT:
P0AB96


Operon      
Name: arsRBC         
Operon arrangement:
Transcription unit        Promoter
arsRBC


Transcriptional Regulation      
Display Regulation             
Repressed by: ArsR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Chaturvedi N., Pandey PN., 2014, Phylogenetic analysis of gammaproteobacterial arsenate reductase proteins specific to Enterobacteriaceae family, signifying arsenic toxicity., Interdiscip Sci 6(1):57-62

 [2] Kaur S., Kamli MR., Ali A., 2009, Diversity of arsenate reductase genes (arsC Genes) from arsenic-resistant environmental isolates of E. coli., Curr Microbiol 59(3):288-94


RegulonDB