RegulonDB RegulonDB 10.9: Gene Form
   

gadX gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

gadA gadX gadY TorR RutR FNR GadX GadY TSS_4129 TSS_4129 gadXp gadXp gadYp gadYp

Gene      
Name: gadX    Texpresso search in the literature
Synonym(s): ECK3501, EG12243, b3516, yhiX
Genome position(nucleotides): 3664986 <-- 3665810 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
40.97
Reference(s): [1] Tramonti A., et al., 2002
External database links:  
ASAP:
ABE-0011487
ECHOBASE:
EB2154
ECOLIHUB:
gadX
OU-MICROARRAY:
b3516
STRING:
511145.b3516
COLOMBOS: gadX


Product      
Name: DNA-binding transcriptional dual regulator GadX
Synonym(s): GadX, YhiX
Sequence: Get amino acid sequence Fasta Format
Regulator Family: AraC/XylS
Cellular location: cytosol
Molecular weight: 31.562
Isoelectric point: 9.107
Motif(s):
 
Type Positions Sequence
164 -> 242 IASELLMSPSLLKKKLREEETSYSQLLTECRMQRALQLIVIHGFSIKRVAVSCGYHSVSYFIYVFRNYYGMTPTEYQER
209 -> 232 IKRVAVSCGYHSVSYFIYVFRNYY
145 -> 242 TRVCTVINNNIAHEWTLARIASELLMSPSLLKKKLREEETSYSQLLTECRMQRALQLIVIHGFSIKRVAVSCGYHSVSYFIYVFRNYYGMTPTEYQER
162 -> 183 ARIASELLMSPSLLKKKLREEE

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.2 - activator
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0003700 - DNA-binding transcription factor activity
GO:0043565 - sequence-specific DNA binding
GO:0042803 - protein homodimerization activity
GO:0000976 - transcription regulatory region sequence-specific DNA binding
GO:0000986 - bacterial-type cis-regulatory region sequence-specific DNA binding
GO:0001216 - DNA-binding transcription activator activity
biological_process GO:0006351 - transcription, DNA-templated
GO:0006355 - regulation of transcription, DNA-templated
GO:0006974 - cellular response to DNA damage stimulus
GO:0045893 - positive regulation of transcription, DNA-templated
Note(s): Note(s): ...[more].
Evidence: [APPH] Assay of protein purified to homogeneity
[GEA] Gene expression analysis
Reference(s): [2] Ma Z., et al., 2002
[1] Tramonti A., et al., 2002
External database links:  
ECOCYC:
EG12243-MONOMER
ECOLIWIKI:
b3516
INTERPRO:
IPR018060
INTERPRO:
IPR020449
INTERPRO:
IPR018062
INTERPRO:
IPR009057
MODBASE:
P37639
PDB:
3MKL
PFAM:
PF12833
PRIDE:
P37639
PRINTS:
PR00032
PRODB:
PRO_000022745
PROSITE:
PS00041
PROSITE:
PS01124
REFSEQ:
NP_417973
SMART:
SM00342
SMR:
P37639
UNIPROT:
P37639


Operon      
Name: gadAXW         
Operon arrangement:
Transcription unit        Promoter
gadW
gadW
gadX
gadXW
gadAX
gadAX


Transcriptional Regulation      
Display Regulation             
Activated by: GadX, GadE-RcsB, PhoB, ArcA, GadW, AdiY, GadE
Repressed by: CRP, FNR, H-NS, GadW, RcsB, TorR, RutR, Fis


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4129 3667155 reverse nd [RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Tramonti A., Visca P., De Canio M., Falconi M., De Biase D., 2002, Functional characterization and regulation of gadX, a gene encoding an AraC/XylS-like transcriptional activator of the Escherichia coli glutamic acid decarboxylase system., J Bacteriol 184(10):2603-13

 [2] Ma Z., Richard H., Tucker DL., Conway T., Foster JW., 2002, Collaborative regulation of Escherichia coli glutamate-dependent acid resistance by two AraC-like regulators, GadX and GadW (YhiW)., J Bacteriol 184(24):7001-12

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB