RegulonDB RegulonDB 10.9: Gene Form
   

yhjJ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yhjJ dctA kdgK anti-anti-terminator anti-terminator terminator yhjJp yhjJp

Gene      
Name: yhjJ    Texpresso search in the literature
Synonym(s): ECK3512, EG12254, b3527
Genome position(nucleotides): 3680444 <-- 3681940 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.44
External database links:  
ASAP:
ABE-0011524
ECHOBASE:
EB2164
ECOLIHUB:
yhjJ
OU-MICROARRAY:
b3527
STRING:
511145.b3527
COLOMBOS: yhjJ


Product      
Name: peptidase M16 family protein YhjJ
Synonym(s): YhjJ
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space
Molecular weight: 55.527
Isoelectric point: 5.804
Motif(s):
 
Type Positions Sequence
1 -> 24 MQGTKIRLLAGGLLMMATAGYVQA
46 -> 158 VLTTPQRPSDRVEIRLLVNTGSLAESTQQSGYSHAIPRIALTQSGGLDAAQARSLWQQGIDPKRPMPPVIVSYDTTLFNLSLPNNRNDLLKEALSYLANATGKLTITPETINH
25 -> 498 DALQPDPAWQQGTLSNGLQWQVLTTPQRPSDRVEIRLLVNTGSLAESTQQSGYSHAIPRIALTQSGGLDAAQARSLWQQGIDPKRPMPPVIVSYDTTLFNLSLPNNRNDLLKEALSYLANATGKLTITPETINHALQSQDMVATWPADTKEGWWRYRLKGSTLLGHDPADPLKQPVEAEKIKDFYQKWYTPDAMTLLVVGNVDARSVVDQINKTFGELKGKRETPAPVPTLSPLRAEAVSIMTDAVRQDRLSIMWDTPWQPIRESAALLRYWRADLAREALFWHVQQALSASNSKDIGLGFDCRVLYLRAQCAINIESPNDKLNSNLNLVARELAKVRDKGLPEEEFNALVAQKKLELQKLFAAYARADTDILMGQRMRSLQNQVVDIAPEQYQKLRQDFLNSLTVEMLNQDLRQQLSNDMALILLQPKGEPEFNMKALQAVWDQIMAPSTAAATTSVATDDVHPEVTDIPPAQ
201 -> 377 EAEKIKDFYQKWYTPDAMTLLVVGNVDARSVVDQINKTFGELKGKRETPAPVPTLSPLRAEAVSIMTDAVRQDRLSIMWDTPWQPIRESAALLRYWRADLAREALFWHVQQALSASNSKDIGLGFDCRVLYLRAQCAINIESPNDKLNSNLNLVARELAKVRDKGLPEEEFNALVAQ

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0042597 - periplasmic space
molecular_function GO:0008233 - peptidase activity
GO:0016787 - hydrolase activity
GO:0046872 - metal ion binding
GO:0008237 - metallopeptidase activity
biological_process GO:0006508 - proteolysis
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG12254-MONOMER
ECOLIWIKI:
b3527
INTERPRO:
IPR011249
INTERPRO:
IPR011765
INTERPRO:
IPR007863
MODBASE:
P37648
PFAM:
PF05193
PFAM:
PF00675
PRIDE:
P37648
REFSEQ:
NP_417984
SMR:
P37648
UNIPROT:
P37648


Operon      
Name: yhjJ         
Operon arrangement:
Transcription unit        Promoter
yhjJ


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB