RegulonDB RegulonDB 10.9: Gene Form
   

eptB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

eptB yhjX proK Fis MgrR terminator eptBp eptBp proKp proKp

Gene      
Name: eptB    Texpresso search in the literature
Synonym(s): ECK3533, EG12267, b3546, yhjW
Genome position(nucleotides): 3708784 <-- 3710475 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.41
External database links:  
ASAP:
ABE-0011581
ECHOBASE:
EB2176
ECOLIHUB:
eptB
OU-MICROARRAY:
b3546
STRING:
511145.b3546
COLOMBOS: eptB


Product      
Name: Kdo2-lipid A phosphoethanolamine 7''-transferase
Synonym(s): EptB, YhjW, phosphoethanolamine transferase EptB
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 63.804
Isoelectric point: 8.843
Motif(s):
 
Type Positions Sequence
160 -> 180 SLAVVVLAGIMVWAPIRLLDI
80 -> 100 LVVLFSAGASYYMTFLNVVIG
118 -> 138 VVGLNFILWLIAVSALPLILI
57 -> 171 LVTFFLLRLLSLFGRRSWRILASLVVLFSAGASYYMTFLNVVIGYGIIASVMTTDIDLSKEVVGLNFILWLIAVSALPLILIWNNRCRYTLLRQLRTPGQRIRSLAVVVLAGIMV
250 -> 538 VVFIIGETTRWDHMGIFGYERNTTPKLAQEKNLAAFRGYSCDTATKLSLRCMFVRQGGAEDNPQRTLKEQNIFAVLKQLGFSSDLYAMQSEMWFYSNTMADNIAYREQIGAEPRNRGKPVDDMLLVDEMQQSLGRNPDGKHLIILHTKGSHFNYTQRYPRSFAQWKPECIGVDSGCTKAQMINSYDNSVTYVDHFISSVIDQVRDKKAIVFYAADHGESINEREHLHGTPRELAPPEQFRVPMMVWMSDKYLENPANAQAFAQLKKEADMKVPRRHVELYDTIMGCLGY

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.3 - lipopolysaccharide --> 1.6.3.2 - core region
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0003824 - catalytic activity
GO:0016740 - transferase activity
GO:0016772 - transferase activity, transferring phosphorus-containing groups
GO:0008484 - sulfuric ester hydrolase activity
GO:0043838 - phosphatidylethanolamine:Kdo2-lipid A phosphoethanolamine transferase activity
biological_process GO:0006629 - lipid metabolic process
GO:0009103 - lipopolysaccharide biosynthetic process
GO:0009244 - lipopolysaccharide core region biosynthetic process
GO:0009245 - lipid A biosynthetic process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG12267-MONOMER
ECOLIWIKI:
b3546
INTERPRO:
IPR040423
INTERPRO:
IPR017850
INTERPRO:
IPR000917
INTERPRO:
IPR012549
MODBASE:
P37661
PANTHER:
PTHR30443
PFAM:
PF00884
PFAM:
PF08019
PRIDE:
P37661
PRODB:
PRO_000022530
REFSEQ:
NP_418002
SMR:
P37661
UNIPROT:
P37661


Operon      
Name: eptB         
Operon arrangement:
Transcription unit        Promoter
eptB
eptB


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB