RegulonDB RegulonDB 10.9: Gene Form
   

yiaK gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yiaK plaR yiaL CRP YiaJ IHF IHF CRP yiaKp2 yiaKp2 yiaKp yiaKp yiaJp yiaJp

Gene      
Name: yiaK    Texpresso search in the literature
Synonym(s): ECK3564, EG12279, b3575
Genome position(nucleotides): 3742733 --> 3743731 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.05
External database links:  
ASAP:
ABE-0011682
ECHOBASE:
EB2187
ECOLIHUB:
yiaK
OU-MICROARRAY:
b3575
STRING:
511145.b3575
COLOMBOS: yiaK


Shine dalgarno      
Sequence: tcaaaaaaacAAGGAAgcctgggATG


Product      
Name: 2,3-diketo-L-gulonate reductase
Synonym(s): YiaK
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 36.573
Isoelectric point: 4.978
Motif(s):
 
Type Positions Sequence
3 -> 330 VTFEQLKAAFNRVLISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQQLENGDIIPDAQPKRITSLGAIEQWDAQRSIGNLTAKKMMDRAIELAADHGIGLVALRNANHWMRGGSYGWQAAEKGYIGICWTNSIAVMPPWGAKECRIGTNPLIVAIPSTPITMVDMSMSMFSYGMLEVNRLAGRQLPVDGGFDDEGNLTKEPGVIEKNRRILPMGYWKGSGMSIVLDMIATLLSDGASVAEVTQDNSDEYGISQIFIAIEVDKLIDGPTRDAKLQRIMDYVTSAERADENQAIRLPGHEFTTLLAENRRNGITVDDSVWAKIQ
168 -> 174 ITMVDMS
304 -> 306 GHE
224 -> 225 WK

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0016491 - oxidoreductase activity
GO:0016616 - oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
GO:0047559 - 3-dehydro-L-gulonate 2-dehydrogenase activity
GO:0070403 - NAD+ binding
biological_process GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG12279-MONOMER
ECOLIWIKI:
b3575
INTERPRO:
IPR043144
INTERPRO:
IPR043143
INTERPRO:
IPR003767
INTERPRO:
IPR023689
INTERPRO:
IPR036111
MODBASE:
P37672
PANTHER:
PTHR11091
PDB:
1S20
PDB:
1NXU
PFAM:
PF02615
PRIDE:
P37672
PRODB:
PRO_000022454
REFSEQ:
NP_418032
SMR:
P37672
UNIPROT:
P37672


Operon      
Name: yiaKLMNO-lyxK-sgbHUE         
Operon arrangement:
Transcription unit        Promoter
yiaKLMNO-lyx-sgbHUE
yiaKLMNO-lyx-sgbHUE


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, IHF
Repressed by: YiaJ
Undetermined regulation CRP
Growth Conditions:

[1] 

C: Escherichia coli| yiaJ knockout mutant| chloroacetic acid| oxygen atom| OD600 of 0.5
E: Escherichia coli| yiaJ knockout mutant| chloroacetic acid| glucose 60 mM| oxygen atom| OD600 of 0.5

[2] 

C: Escherichia coli| yiaJ knockout mutant| chloroacetic acid| glucose 60 mM| oxygen atom| OD600 of 0.5
E: Escherichia coli| yiaJ knockout mutant| chloroacetic acid| cAMP 5 mM; glucose 60 mM| oxygen atom| OD600 of 0.5

[3] 

C: Escherichia coli| chloroacetic acid| oxygen atom| OD600 of 0.5
E: Escherichia coli| chloroacetic acid| L-ascorbate 60 mM| oxygen atom| OD600 of 0.5

[4] 

C: Escherichia coli| yiaJ knockout mutant| chloroacetic acid| oxygen atom| OD600 of 0.5
E: Escherichia coli| yiaJ knockout mutant| succinate 60 mM| oxygen atom| OD600 of 0.5

[5] 

C: Escherichia coli| yiaJ knockout mutant| chloroacetic acid| glucose 120 mM| OD600 of 0.25
E: Escherichia coli| yiaJ knockout mutant| chloroacetic acid| cAMP 5 mM; glucose 120 mM| OD600 of 0.25

[6] 

C: Escherichia coli| chloroacetic acid| oxygen atom| OD600 of 0.5
E: Escherichia coli| yiaJ knockout mutant| chloroacetic acid| oxygen atom| OD600 of 0.5

[7] 

C:
E: Escherichia coli| yiaJ knockout mutant| chloroacetic acid| OD650 of 0.5

[8] 

C: Escherichia coli| chloroacetic acid| oxygen atom| OD600 of 0.5
E: Escherichia coli| chloroacetic acid| L-fucose 60 mM| oxygen atom| OD600 of 0.5

[9] 

C: Escherichia coli| yiaJ knockout mutant| chloroacetic acid| OD600 of 0.25
E: Escherichia coli| yiaJ knockout mutant| chloroacetic acid| glucose 120 mM| OD600 of 0.25



Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB