RegulonDB RegulonDB 10.9: Gene Form
   

yiaN gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yiaN yiaO yiaM

Gene      
Name: yiaN    Texpresso search in the literature
Synonym(s): ECK3567, EG12282, b3578
Genome position(nucleotides): 3744804 --> 3746081 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.86
External database links:  
ASAP:
ABE-0011692
ECHOBASE:
EB2190
ECOLIHUB:
yiaN
OU-MICROARRAY:
b3578
STRING:
511145.b3578
COLOMBOS: yiaN


Product      
Name: 2,3-diketo-L-gulonate:Na+ symporter - membrane subunit
Synonym(s): YiaN
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 45.368
Isoelectric point: 8.053
Motif(s):
 
Type Positions Sequence
3 -> 23 VLIFLGCLLGGIAIGLPIAWA
54 -> 74 FSLLAIPFFVLAGEIMNAGGL
7 -> 415 LGCLLGGIAIGLPIAWALLLCGAALMFWLDMFDVQIMAQTLVNGADSFSLLAIPFFVLAGEIMNAGGLSKRIVDLPMKLVGHKPGGLGYVGVLAAMIMASLSGSAVADTAAVAALLVPMMRSANYPVNRAAGLIASGGIIAPIIPPSIPFIIFGVSSGLSISKLFMAGIAPGMMMGATLMLTWWWQASRLNLPRQQKATMQEIWHSFVSGIWALFLPVIIIGGFRSGLFTPTEAGAVAAFYALFVATVIYREMTFATLWHVLIGAAKTTSVVMFLVASAQVSAWLITIAELPMMVSDLLQPLVDSPRLLFIVIMVAILIVGMVMDLTPTVLILTPVLMPLVKEAGIDPIYFGVMFIINCSIGLITPPIGNVLNVISGVAKLKFDDAVRGVFPYVLVLYSLLVVFVFIPD
399 -> 419 YVLVLYSLLVVFVFIPDLIIL
93 -> 113 LGYVGVLAAMIMASLSGSAVA

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.2 - Electrochemical potential driven transporters --> 4.2.A - Porters (Uni-, Sym- and Antiporters)
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0015144 - carbohydrate transmembrane transporter activity
GO:0022857 - transmembrane transporter activity
biological_process GO:0034219 - carbohydrate transmembrane transport
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG12282-MONOMER
ECOLIWIKI:
b3578
INTERPRO:
IPR010656
INTERPRO:
IPR004681
PANTHER:
PTHR33362
PFAM:
PF06808
PRIDE:
P37675
REFSEQ:
YP_026232
UNIPROT:
P37675


Operon      
Name: yiaKLMNO-lyxK-sgbHUE         
Operon arrangement:
Transcription unit        Promoter
yiaKLMNO-lyx-sgbHUE
yiaKLMNO-lyx-sgbHUE


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, IHF
Repressed by: YiaJ
Undetermined regulation CRP


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB