RegulonDB RegulonDB 10.9: Gene Form
   

lyxK gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

lyxK yiaO sgbU sgbH sgbE

Gene      
Name: lyxK    Texpresso search in the literature
Synonym(s): ECK3569, EG12284, b3580, lyx, sgbK, xylK, yiaP
Genome position(nucleotides): 3747084 --> 3748580 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
57.45
Reference(s): [1] Yew WS., et al., 2002
External database links:  
ASAP:
ABE-0011696
CGSC:
36908
ECHOBASE:
EB2192
ECOLIHUB:
lyxK
ECOO157CYC:
Z4878
OU-MICROARRAY:
b3580
STRING:
511145.b3580
COLOMBOS: lyxK


Product      
Name: L-xylulose kinase
Synonym(s): Lyx, LyxK, SgbK, XylK, YiaP
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 55.155
Isoelectric point: 5.995
Motif(s):
 
Type Positions Sequence
260 -> 440 NAVMGTWAVTSGITRGLRDGEAHPYVYGRYVNDGEFIVHEASPTSSGNLEWFTAQWGEISFDEINQAVASLPKAGGDLFFLPFLYGSNAGLEMTSGFYGMQAIHTRAHLLQAIYEGVVFSHMTHLNRMRERFTDVHTLRVTGGPAHSDVWMQMLADVSGLRIELPQVEETGCFGAALAARV
4 -> 250 YWLGLDCGGSWLKAGLYDREGREAGVQRLPLCALSPQPGWAERDMAELWQCCMAVIRALLTHSGVSGEQIVGIGISAQGKGLFLLDKNDKPLGNAILSSDRRAMEIVRRWQEDGIPEKLYPLTRQTLWTGHPVSLLRWLKEHEPERYAQIGCVMMTHDYLRWCLTGVKGCEESNISESNLYNMSLGEYDPCLTDWLGIAEINHALPPVVGSAEICGEITAQTAALTGLKAGTPVVGGLFDVVSTALC

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016740 - transferase activity
GO:0016301 - kinase activity
GO:0016773 - phosphotransferase activity, alcohol group as acceptor
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0008744 - L-xylulokinase activity
GO:0042803 - protein homodimerization activity
biological_process GO:0005975 - carbohydrate metabolic process
GO:0016310 - phosphorylation
GO:0019324 - L-lyxose metabolic process
GO:0046835 - carbohydrate phosphorylation
Note(s): Note(s): ...[more].
Reference(s): [2] Han Q., et al., 2017
[3] Ibanez E., et al., 2000
[1] Yew WS., et al., 2002
External database links:  
ECOCYC:
LYXK-MONOMER
ECOLIWIKI:
b3580
ECOO157CYC:
Z4878-MONOMER
INTERPRO:
IPR000577
INTERPRO:
IPR043129
INTERPRO:
IPR018485
INTERPRO:
IPR018484
INTERPRO:
IPR018483
MODBASE:
P37677
PFAM:
PF02782
PFAM:
PF00370
PRIDE:
P37677
PRODB:
PRO_000023142
PROSITE:
PS00445
REFSEQ:
NP_418037
SMR:
P37677
UNIPROT:
P37677


Operon      
Name: yiaKLMNO-lyxK-sgbHUE         
Operon arrangement:
Transcription unit        Promoter
yiaKLMNO-lyx-sgbHUE
yiaKLMNO-lyx-sgbHUE


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, IHF
Repressed by: YiaJ
Undetermined regulation CRP


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Yew WS., Gerlt JA., 2002, Utilization of L-ascorbate by Escherichia coli K-12: assignments of functions to products of the yjf-sga and yia-sgb operons., J Bacteriol 184(1):302-6

 [2] Han Q., Eiteman MA., 2017, Coupling xylitol dehydrogenase with NADH oxidase improves l-xylulose production in Escherichia coli culture., Enzyme Microb Technol 106:106-113

 [3] Ibanez E., Gimenez R., Pedraza T., Baldoma L., Aguilar J., Badia J., 2000, Role of the yiaR and yiaS genes of Escherichia coli in metabolism of endogenously formed L-xylulose., J Bacteriol 182(16):4625-7


RegulonDB