RegulonDB RegulonDB 10.9: Gene Form
   

tmk gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

mltG holB pabC ycfH tmk TSS_1420 TSS_1420 TSS_1419 TSS_1419 TSS_1418 TSS_1418

Gene      
Name: tmk    Texpresso search in the literature
Synonym(s): ECK1084, EG12302, b1098, ycfG
Genome position(nucleotides): 1155124 --> 1155765 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.05
External database links:  
ASAP:
ABE-0003714
ECHOBASE:
EB2208
ECOLIHUB:
tmk
OU-MICROARRAY:
b1098
STRING:
511145.b1098
COLOMBOS: tmk


Product      
Synonym(s): Tmk, YcfG
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 23.783
Isoelectric point: 5.169
Motif(s):
 
Type Positions Sequence
147 -> 159 LKRARARGELDRI
8 -> 200 IEGLEGAGKTTARNVVVETLEQLGIRDMVFTREPGGTQLAEKLRSLVLDIKSVGDEVITDKAEVLMFYAARVQLVETVIKPALANGTWVIGDRHDLSTQAYQGGGRGIDQHMLATLRDAVLGDFRPDLTLYLDVTPEVGLKRARARGELDRIEQESFDFFNRTRARYLELAAQDKSIHTIDATQPLEAVMDAI
112 -> 112 G
122 -> 122 T
10 -> 17 GLEGAGKT

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.33 - nucleotide and nucleoside conversions
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0016740 - transferase activity
GO:0016301 - kinase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0004798 - thymidylate kinase activity
GO:0009041 - uridylate kinase activity
GO:0042803 - protein homodimerization activity
biological_process GO:0046940 - nucleoside monophosphate phosphorylation
GO:0009165 - nucleotide biosynthetic process
GO:0015949 - nucleobase-containing small molecule interconversion
GO:0016310 - phosphorylation
GO:0006233 - dTDP biosynthetic process
GO:0006235 - dTTP biosynthetic process
GO:0006227 - dUDP biosynthetic process
External database links:  
DIP:
DIP-48110N
ECOCYC:
DTMPKI-MONOMER
ECOLIWIKI:
b1098
INTERPRO:
IPR027417
INTERPRO:
IPR039430
INTERPRO:
IPR018095
INTERPRO:
IPR018094
MODBASE:
P0A720
PDB:
1E9F
PDB:
5TMP
PDB:
4TMK
PFAM:
PF02223
PRIDE:
P0A720
PROSITE:
PS01331
REFSEQ:
NP_415616
SMR:
P0A720
UNIPROT:
P0A720


Operon      
Name: pabC-mltG-tmk-holB-ycfH         
Operon arrangement:
Transcription unit        Promoter
pabC-mltG-tmk-holB-ycfH


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1418 1155058 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1419 1156471 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1420 1156478 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB