RegulonDB RegulonDB 10.9: Gene Form
   

ycfH gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ptsG holB ycfH tmk Fis ArcA Mlc Fis CRP ArcA Fis ArcA SoxS CRP Fis Fis Mlc SgrS TSS_1432 (cluster) TSS_1432 (cluster) TSS_1431 TSS_1431 TSS_1430 TSS_1430 TSS_1429 (cluster) TSS_1429 (cluster) TSS_1428 TSS_1428 TSS_1427 TSS_1427 TSS_1426 (cluster) TSS_1426 (cluster) TSS_1425 (cluster) TSS_1425 (cluster) TSS_1424 TSS_1424 TSS_1423 TSS_1423 ptsGp1 ptsGp1 TSS_1421 TSS_1421 ptsGp2 ptsGp2 TSS_1420 TSS_1420 TSS_1419 TSS_1419

Gene      
Name: ycfH    Texpresso search in the literature
Synonym(s): ECK1086, EG12303, b1100
Genome position(nucleotides): 1156777 --> 1157574 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.88
External database links:  
ASAP:
ABE-0003719
ECHOBASE:
EB2209
ECOLIHUB:
ycfH
OU-MICROARRAY:
b1100
STRING:
511145.b1100
COLOMBOS: ycfH


Product      
Name: putative metal-dependent hydrolase YcfH
Synonym(s): YcfH
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 29.809
Isoelectric point: 5.067
Motif(s):
 
Type Positions Sequence
4 -> 255 VDSHCHLDGLDYESLHKDVDDVLAKAAARDVKFCLAVATTLPGYLHMRDLVGERDNVVFSCGVHPLNQNDPYDVEDLRRLAAEEGVVALGETGLDYYYTPETKVRQQESFIHHIQIGRELNKPVIVHTRDARADTLAILREEKVTDCGGVLHCFTEDRETAGKLLDLGFYISFSGIVTFRNAEQLRDAARYVPLDRLLVETDSPYLAPVPHRGKENQPAMVRDVAEYMAVLKGVAVEELAQVTTDNFARLFH
97 -> 97 L

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016788 - hydrolase activity, acting on ester bonds
GO:0004536 - deoxyribonuclease activity
GO:0005515 - protein binding
GO:0016787 - hydrolase activity
GO:0046872 - metal ion binding
GO:0016888 - endodeoxyribonuclease activity, producing 5'-phosphomonoesters
biological_process GO:0006259 - DNA metabolic process
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-48157N
ECOCYC:
EG12303-MONOMER
ECOLIWIKI:
b1100
INTERPRO:
IPR001130
INTERPRO:
IPR032466
INTERPRO:
IPR018228
INTERPRO:
IPR015991
MODBASE:
P0AFQ7
PDB:
1YIX
PFAM:
PF01026
PRIDE:
P0AFQ7
PROSITE:
PS01091
PROSITE:
PS01137
REFSEQ:
NP_415618
SMR:
P0AFQ7
SWISSMODEL:
P0AFQ7
UNIPROT:
P0AFQ7


Operon      
Name: pabC-mltG-tmk-holB-ycfH         
Operon arrangement:
Transcription unit        Promoter
pabC-mltG-tmk-holB-ycfH


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1419 1156471 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1420 1156478 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1421 1157737 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1423 1158280 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1424 1158634 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1425 (cluster) 1158640 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_1426 (cluster) 1158878 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_1427 1158897 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1428 1158901 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1429 (cluster) 1158904 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_1430 1158907 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1431 1159132 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1432 (cluster) 1159175 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB