RegulonDB RegulonDB 10.9: Gene Form
   

yjtD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yjtD yjjY thrL FNR DksA-ppGpp DksA-ppGpp Cis-reg; leader anti-terminator anti-anti-terminator thrLp thrLp TSS_1 TSS_1 yjtDp6 yjtDp6 yjtDp8 yjtDp8 arcAp7 arcAp7 arcAp6 arcAp6 arcAp5 arcAp5 TSS_5196 TSS_5196 TSS_5195 TSS_5195 arcAp4 arcAp4 arcAp3 arcAp3 TSS_5194 TSS_5194 arcAp2 arcAp2 arcAp1 arcAp1 TSS_5192 TSS_5192 TSS_5191 TSS_5191 TSS_5190 (cluster) TSS_5190 (cluster)

Gene      
Name: yjtD    Texpresso search in the literature
Synonym(s): ECK4395, EG12309, b4403, lasT
Genome position(nucleotides): 4640942 --> 4641628 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.78
External database links:  
ASAP:
ABE-0014442
ECHOBASE:
EB2215
ECOLIHUB:
yjtD
OU-MICROARRAY:
b4403
STRING:
511145.b4403
COLOMBOS: yjtD


Product      
Name: putative rRNA methyltransferase
Synonym(s): LasT, YjtD
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 25.259
Isoelectric point: 5.83
Motif(s):
 
Type Positions Sequence
140 -> 142 PSL
31 -> 31 L
3 -> 153 ITIILVAPARAENIGAAARAMKTMGFSDLRIVDSQAHLEPATRWVAHGSGDIIDNIKVFPTLAESLHDVDFTVATTARSRAKYHYYATPVELVPLLEEKSSWMSHAALVFGREDSGLTNEELALADVLTGVPMVADYPSLNLGQAVMVYCY
77 -> 79 TTA

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0008168 - methyltransferase activity
GO:0016740 - transferase activity
GO:0008173 - RNA methyltransferase activity
GO:0003723 - RNA binding
GO:0052665 - tRNA (uracil-2'-O-)-methyltransferase activity
GO:0052666 - tRNA (cytosine-2'-O-)-methyltransferase activity
biological_process GO:0006396 - RNA processing
GO:0032259 - methylation
GO:0002128 - tRNA nucleoside ribose methylation
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-10084N
ECOCYC:
EG12309-MONOMER
ECOLIWIKI:
b4403
INTERPRO:
IPR029026
INTERPRO:
IPR004384
INTERPRO:
IPR001537
INTERPRO:
IPR029028
MODBASE:
P37005
PANTHER:
PTHR42786
PFAM:
PF00588
PRIDE:
P37005
REFSEQ:
NP_418820
SMR:
P37005
UNIPROT:
P37005


Operon      
Name: yjtD         
Operon arrangement:
Transcription unit        Promoter
yjtD


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1 38 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB