RegulonDB RegulonDB 10.9: Gene Form
   

yacG gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

zapD mutT yacG b0100 TSS_224 TSS_224 TSS_223 TSS_223 TSS_222 TSS_222

Gene      
Name: yacG    Texpresso search in the literature
Synonym(s): ECK0101, EG12314, b0101
Genome position(nucleotides): 111649 <-- 111846 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.52
External database links:  
ASAP:
ABE-0000351
ECHOBASE:
EB2220
ECOLIHUB:
yacG
OU-MICROARRAY:
b0101
STRING:
511145.b0101
COLOMBOS: yacG


Product      
Name: DNA gyrase inhibitor YacG
Synonym(s): YacG
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 7.306
Isoelectric point: 4.215
Motif(s):
 
Type Positions Sequence
7 -> 56 VNCPTCGKTVVWGEISPFRPFCSKRCQLIDLGEWAAEEKRIPSSGDLSES

 

Classification:
Multifun Terms (GenProtEC)  
  3 - regulation --> 3.1 - type of regulation --> 3.1.3 - posttranscriptional --> 3.1.3.3 - inhibition / activation of enzymes
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0046872 - metal ion binding
GO:0008270 - zinc ion binding
GO:0008657 - DNA topoisomerase type II (double strand cut, ATP-hydrolyzing) inhibitor activity
biological_process GO:0006355 - regulation of transcription, DNA-templated
GO:2000372 - negative regulation of DNA topoisomerase (ATP-hydrolyzing) activity
Note(s): Note(s): ...[more].
Evidence: [APPH] Assay of protein purified to homogeneity
Reference(s): [1] Sengupta S., et al., 2008
External database links:  
DIP:
DIP-48126N
ECOCYC:
EG12314-MONOMER
ECOLIWIKI:
b0101
INTERPRO:
IPR013088
INTERPRO:
IPR005584
MODBASE:
P0A8H8
PANTHER:
PTHR36150
PDB:
4TMA
PDB:
1LV3
PFAM:
PF03884
PRIDE:
P0A8H8
REFSEQ:
NP_414643
SMR:
P0A8H8
UNIPROT:
P0A8H8


Operon      
Name: coaE-zapD-yacG         
Operon arrangement:
Transcription unit        Promoter
yacG
coaE-zapD-yacG


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_222 112251 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_223 112273 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_224 112599 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Sengupta S., Nagaraja V., 2008, YacG from Escherichia coli is a specific endogenous inhibitor of DNA gyrase., Nucleic Acids Res 36(13):4310-6

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB