RegulonDB RegulonDB 11.1: Gene Form

yacH gene in Escherichia coli K-12 genome

Gene local context to scale (view description)

acnB yacH lpd Fis CRP ArcA ArcA Fis ArcA ArcA ArcA ArcA ArcA Fis terminator anti-terminator anti-anti-terminator TSS_259 TSS_259 TSS_258 TSS_258 TSS_257 TSS_257 TSS_256 TSS_256 TSS_255 TSS_255 acnBp2 acnBp2 acnBp1 acnBp1 yacHp5 yacHp5 yacHp3 yacHp3 TSS_254 TSS_254 TSS_253 TSS_253 TSS_252 TSS_252

Name: yacH    Texpresso search in the literature
Synonym(s): ECK0116, EG12315, b0117
Genome position(nucleotides): 129407 <-- 131260
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
External database links:  

Name: DUF3300 domain-containing protein YacH
Synonym(s): YacH
Sequence: Get amino acid sequence Fasta Format
Cellular location: extracellular space
Molecular weight: 69.362
Isoelectric point: 8.697
Type Positions Sequence Comment
387 -> 419 NGGMSATQLPAPTRDSQRQAAANQFQQRTHAAP UniProt: Disordered; Sequence Annotation Type: region of interest.
452 -> 484 RQPLTQQQKDAARQRYQSASPEQRQAVRERMQT UniProt: Polar residues; Sequence Annotation Type: compositionally biased region.
485 -> 500 NPKIQQRREAARERIQ UniProt: Basic and acidic residues; Sequence Annotation Type: compositionally biased region.


Multifun Terms (GenProtEC)  
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0005576 - extracellular region
Note(s): Note(s): ...[more].
External database links:  

Name: yacH         
Operon arrangement:
Transcription unit        Promoter

Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_252 127929 forward nd [RS-EPT-CBR] [1]
  promoter TSS_253 127953 forward nd [RS-EPT-CBR] [1]
  promoter TSS_254 130229 forward nd [RS-EPT-CBR] [1]
  promoter yacHp3 131307 reverse nd [COMP-AINF] [2]
  promoter yacHp5 131466 reverse nd [COMP-AINF] [2]
  promoter TSS_255 131743 forward nd [RS-EPT-CBR] [1]
  promoter TSS_256 132124 forward nd [RS-EPT-CBR] [1]
  promoter TSS_257 132840 forward nd [RS-EPT-CBR] [1]
  promoter TSS_258 133449 forward nd [RS-EPT-CBR] [1]
  promoter TSS_259 133468 forward nd [RS-EPT-CBR] [1]


 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [COMP-AINF] Inferred computationally without human oversight


 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78
