RegulonDB RegulonDB 10.9: Gene Form
   

yacH gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

Gene      
Name: yacH    Texpresso search in the literature
Synonym(s): ECK0116, EG12315, b0117
Genome position(nucleotides): 129407 <-- 131260 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.88
External database links:  
ASAP:
ABE-0000406
ECHOBASE:
EB2221
ECOLIHUB:
yacH
OU-MICROARRAY:
b0117
STRING:
511145.b0117
COLOMBOS: yacH


Product      
Name: DUF3300 domain-containing protein YacH
Synonym(s): YacH
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 69.362
Isoelectric point: 8.697
Motif(s):
 
Type Positions Sequence
75 -> 339 TAQIDQWVAPVALYPDALLSQVLMASTYPTNVAQAVQWSHDNPLKQGDAAIQAVSDQPWDASVKSLVAFPQLMALMGENPQWVQNLGDAFLAQPQDVMDSVQRLRQLAQQTGSLKSSTEQKVITTTKKAVPVKQTVTAPVIPSNTVLTANPVITEPATTVISIEPANPDVVYIPNYNPTVVYGNWANTAYPPVYLPPPAGEPFVDSFVRGFGYSMGVATTYALFSSIDWDDDDHDHHHHDNDDYHHHDGGHRDGNGWQHNGDNIN
523 -> 523 R

 

Classification:
Multifun Terms (GenProtEC)  
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG12315-MONOMER
ECOLIWIKI:
b0117
INTERPRO:
IPR021728
PANTHER:
PTHR40269
PFAM:
PF11737
PRIDE:
P36682
REFSEQ:
NP_414659
UNIPROT:
P36682


Operon      
Name: yacH         
Operon arrangement:
Transcription unit        Promoter
yacH


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_252 127929 forward nd [RS-EPT-CBR] [1]
  promoter TSS_253 127953 forward nd [RS-EPT-CBR] [1]
  promoter TSS_254 130229 forward nd [RS-EPT-CBR] [1]
  promoter yacHp3 131307 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yacHp5 131466 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_255 131743 forward nd [RS-EPT-CBR] [1]
  promoter TSS_256 132124 forward nd [RS-EPT-CBR] [1]
  promoter TSS_257 132840 forward nd [RS-EPT-CBR] [1]
  promoter TSS_258 133449 forward nd [RS-EPT-CBR] [1]
  promoter TSS_259 133468 forward nd [RS-EPT-CBR] [1]



RegulonDB