RegulonDB RegulonDB 10.9: Gene Form
   

can gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

Gene      
Name: can    Texpresso search in the literature
Synonym(s): ECK0125, EG12319, b0126, yadF
Genome position(nucleotides): 142008 <-- 142670 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.68
External database links:  
ASAP:
ABE-0000442
ECHOBASE:
EB2224
ECOLIHUB:
can
OU-MICROARRAY:
b0126
STRING:
511145.b0126
COLOMBOS: can


Product      
Name: carbonic anhydrase 2
Synonym(s): Can, CynT2, YadF
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 25.097
Isoelectric point: 6.649
Motif(s):
 
Type Positions Sequence
38 -> 187 LWIGCSDSRVPAERLTGLEPGELFVHRNVANLVIHTDLNCLSVVQYAVDVLEVEHIIICGHYGCGGVQAAVENPELGLINNWLLHIRDIWFKHSSLLGEMPQERRLDTLCELNVMEQVYNLGHSTIMQSAWKRGQKVTIHGWAYGIHDGL

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.1 - unassigned reversible reactions
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0016829 - lyase activity
GO:0046872 - metal ion binding
GO:0004089 - carbonate dehydratase activity
GO:0008270 - zinc ion binding
GO:0042802 - identical protein binding
biological_process GO:0015976 - carbon utilization
GO:0051289 - protein homotetramerization
Note(s): Note(s): ...[more].
Reference(s): [1] Hewett-Emmett D., et al., 1996
[2] Nocentini A., et al., 2020
External database links:  
DIP:
DIP-36168N
ECOCYC:
EG12319-MONOMER
ECOLIWIKI:
b0126
INTERPRO:
IPR036874
INTERPRO:
IPR015892
INTERPRO:
IPR001765
MODBASE:
P61517
PDB:
1I6P
PDB:
2ESF
PDB:
1T75
PDB:
1I6O
PFAM:
PF00484
PRIDE:
P61517
PROSITE:
PS00705
PROSITE:
PS00704
REFSEQ:
NP_414668
SMART:
SM00947
SMR:
P61517
UNIPROT:
P61517


Operon      
Name: can         
Operon arrangement:
Transcription unit        Promoter
can
can


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_268 141650 forward nd [RS-EPT-CBR] [3]



RegulonDB