RegulonDB RegulonDB 10.9: Gene Form
   

hrpB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

mrcB hrpB thpR CRP mrcBp mrcBp TSS_288 TSS_288 TSS_287 TSS_287 hrpBp2 hrpBp2 TSS_286 TSS_286 sfsAp sfsAp

Gene      
Name: hrpB    Texpresso search in the literature
Synonym(s): ECK0147, EG12329, b0148, yadO
Genome position(nucleotides): 162105 --> 164534 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.58
External database links:  
ASAP:
ABE-0000510
CGSC:
36926
ECHOBASE:
EB2233
ECOLIHUB:
hrpB
OU-MICROARRAY:
b0148
STRING:
511145.b0148
COLOMBOS: hrpB


Product      
Name: RNA-dependent NTPase HrpB
Synonym(s): HrpB, YadO, putative ATP-dependent RNA helicase HrpB
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 89.148
Isoelectric point: 6.465
Motif(s):
 
Type Positions Sequence
27 -> 34 APTGAGKS
207 -> 327 MLRQESGSLLLFLPGVGEIQRVQEQLASRIGSDVLLCPLYGALSLNDQRKAILPAPQGMRKVVLATNIAETSLTIEGIRLVVDCAQERVARFDPRTGLTRLITQRVSQASMTQRAGRAGRL
123 -> 126 DEFH
389 -> 444 AKRLLQMLGALEGERLSAQGQKMAALGNDPRLAAMLVSAKNDDEAATAAKIAAILE
21 -> 163 PQVLLSAPTGAGKSTWLPLQLLAHPGINGKIILLEPRRLAARNVAQRLAELLNEKPGDTVGYRMRAQNCVGPNTRLEVVTEGVLTRMIQRDPELSGVGLVILDEFHERSLQADLALALLLDVQQGLRDDLKLLIMSATLDNDR

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
molecular_function GO:0003676 - nucleic acid binding
GO:0004386 - helicase activity
GO:0016787 - hydrolase activity
GO:0017111 - nucleoside-triphosphatase activity
GO:0003727 - single-stranded RNA binding
GO:0000166 - nucleotide binding
GO:0003724 - RNA helicase activity
GO:0005524 - ATP binding
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-9938N
ECOCYC:
EG12329-MONOMER
ECOLIWIKI:
b0148
INTERPRO:
IPR007502
INTERPRO:
IPR013689
INTERPRO:
IPR014001
INTERPRO:
IPR001650
INTERPRO:
IPR027417
INTERPRO:
IPR010225
INTERPRO:
IPR011545
MODBASE:
P37024
PANTHER:
PTHR43519
PDB:
6HEG
PDB:
6EUD
PFAM:
PF04408
PFAM:
PF00271
PFAM:
PF00270
PFAM:
PF08482
PRIDE:
P37024
PRODB:
PRO_000022923
PROSITE:
PS51194
PROSITE:
PS51192
REFSEQ:
NP_414690
SMART:
SM00490
SMART:
SM00487
SMART:
SM00847
SMR:
P37024
UNIPROT:
P37024


Operon      
Name: hrpB         
Operon arrangement:
Transcription unit        Promoter
hrpB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_286 161665 forward nd [RS-EPT-CBR] [1]
  promoter hrpBp2 162075 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_287 162077 forward nd [RS-EPT-CBR] [1]
  promoter TSS_288 164658 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB