RegulonDB RegulonDB 10.8: Gene Form
   

thpR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

hrpB sfsA thpR CRP TSS_287 TSS_287 hrpBp2 hrpBp2 TSS_286 TSS_286 sfsAp sfsAp TSS_285 TSS_285 TSS_284 (cluster) TSS_284 (cluster) TSS_283 TSS_283 TSS_282 TSS_282 TSS_281 (cluster) TSS_281 (cluster) TSS_280 TSS_280 TSS_279 TSS_279 TSS_278 TSS_278

Gene      
Name: thpR    Texpresso search in the literature
Synonym(s): ECK0146, EG12330, b0147, ligT, yadP
Genome position(nucleotides): 161501 <-- 162031 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.93
External database links:  
ASAP:
ABE-0000505
ECHOBASE:
EB2234
OU-MICROARRAY:
b0147
PortEco:
ligT
STRING:
511145.b0147
COLOMBOS: thpR


Product      
Name: RNA 2',3'-cyclic phosphodiesterase
Synonym(s): LigT, ThpR, YadP
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 19.934
Isoelectric point: 10.979
Motif(s):
 
Type Positions Sequence
92 -> 164 MRQPPRGLIQLANMLRSQAARSGCFQSNRPFHPHITLLRDASEAVTIPPPGFNWSYAVTEFTLYASSFARGRT
45 -> 45 T
127 -> 127 T
48 -> 48 F
11 -> 89 IDLPAEIREQIIHWRATHFPPEAGRPVAADNLHLTLAFLGEVSAEKEKALSLLAGRIRQPGFTLTLDDAGQWLRSRVVW

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016787 - hydrolase activity
GO:0008081 - phosphoric diester hydrolase activity
GO:0008664 - 2'-5'-RNA ligase activity
GO:0004113 - 2',3'-cyclic-nucleotide 3'-phosphodiesterase activity
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG12330-MONOMER
ECOLIWIKI:
b0147
INTERPRO:
IPR014051
INTERPRO:
IPR009097
INTERPRO:
IPR004175
MODBASE:
P37025
PANTHER:
PTHR35561
PDB:
4QAK
PFAM:
PF02834
PRIDE:
P37025
PRODB:
PRO_000023091
REFSEQ:
NP_414689
SMR:
P37025
UNIPROT:
P37025


Operon      
Name: thpR         
Operon arrangement:
Transcription unit        Promoter
ligT


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_278 160873 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_279 160884 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_280 161071 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_281 (cluster) 161079 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_282 161142 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_283 161187 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_284 (cluster) 161195 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_285 161199 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_286 161665 forward nd [RS-EPT-CBR] [1]
  promoter hrpBp2 162075 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_287 162077 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB