RegulonDB RegulonDB 10.8: Gene Form
   

erpA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

clcA yadS erpA yadW IscR TSS_300 TSS_300 erpAp erpAp TSS_298 TSS_298 TSS_297 TSS_297

Gene      
Name: erpA    Texpresso search in the literature
Synonym(s): ECK0155, EG12332, b0156, yadR
Genome position(nucleotides): 176610 --> 176954 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.72
External database links:  
ASAP:
ABE-0000538
ECHOBASE:
EB2236
MIM:
616370
OU-MICROARRAY:
b0156
PortEco:
erpA
STRING:
511145.b0156
COLOMBOS: erpA


Product      
Name: iron-sulfur cluster insertion protein ErpA
Synonym(s): ErpA, YadR, essential respiratory protein A
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 12.1
Isoelectric point: 3.897
Motif(s):
 
Type Positions Sequence
9 -> 109 LEFTDAAANKVKSLIADEDNPNLKLRVYITGGGCSGFQYGFTFDDQVNEGDMTIEKQGVGLVVDPMSLQYLVGGSVDYTEGLEGSRFIVTNPNAKSTCGCG
106 -> 106 C
108 -> 108 C
42 -> 42 C

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.6 - aerobic respiration
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.7 - anaerobic respiration
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0005198 - structural molecule activity
GO:0046872 - metal ion binding
GO:0051536 - iron-sulfur cluster binding
GO:0051539 - 4 iron, 4 sulfur cluster binding
GO:0051537 - 2 iron, 2 sulfur cluster binding
GO:0005506 - iron ion binding
biological_process GO:0106035 - protein maturation by [4Fe-4S] cluster transfer
GO:0009060 - aerobic respiration
GO:0009061 - anaerobic respiration
GO:0016226 - iron-sulfur cluster assembly
GO:0051604 - protein maturation
GO:0097428 - protein maturation by iron-sulfur cluster transfer
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-48196N
ECOCYC:
EG12332-MONOMER
ECOLIWIKI:
b0156
INTERPRO:
IPR016092
INTERPRO:
IPR035903
INTERPRO:
IPR023063
INTERPRO:
IPR017870
INTERPRO:
IPR000361
MODBASE:
P0ACC3
PFAM:
PF01521
PRIDE:
P0ACC3
PRODB:
PRO_000022532
PROSITE:
PS01152
REFSEQ:
NP_414698
SMR:
P0ACC3
SWISSMODEL:
P0ACC3
UNIPROT:
P0ACC3


Operon      
Name: erpA         
Operon arrangement:
Transcription unit        Promoter
erpA


Transcriptional Regulation      
Display Regulation             
Repressed by: IscR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_297 176147 forward nd [RS-EPT-CBR] [1]
  promoter TSS_298 176558 forward nd [RS-EPT-CBR] [1]
  promoter TSS_300 176583 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB