RegulonDB RegulonDB 10.9: Gene Form
   

yadS gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

btuF yadS erpA yadW mtn yadSp5 yadSp5 yadSp7 yadSp7 yadSp6 yadSp6

Gene      
Name: yadS    Texpresso search in the literature
Synonym(s): ECK0156, EG12333, b0157
Genome position(nucleotides): 177001 <-- 177624 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.69
External database links:  
ASAP:
ABE-0000540
ECHOBASE:
EB2237
ECOLIHUB:
yadS
OU-MICROARRAY:
b0157
STRING:
511145.b0157
COLOMBOS: yadS


Product      
Name: PF03458 family protein YadS
Synonym(s): YadS, conserved inner membrane protein YadS
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 22.128
Isoelectric point: 8.726
Motif(s):
 
Type Positions Sequence
86 -> 106 PKWMLPVLDAVGLAVFVGIGV
30 -> 50 FGVLVLGVVTAVGGGTIRDMA
149 -> 169 IYATACIIGGIVHATAYYTFS
92 -> 163 VLDAVGLAVFVGIGVNKAFNAEAGPLIAVCMGVITGVGGGIIRDVLAREIPMILRTEIYATACIIGGIVHAT
113 -> 133 EAGPLIAVCMGVITGVGGGII

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
Note(s): Note(s): ...[more].
Reference(s): [1] Cadieux N., et al., 2002
[2] Jindal S., et al., 2019
External database links:  
ECOCYC:
EG12333-MONOMER
ECOLIWIKI:
b0157
INTERPRO:
IPR005115
PFAM:
PF03458
PRIDE:
P0AFP0
REFSEQ:
NP_414699
SMR:
P0AFP0
UNIPROT:
P0AFP0


Operon      
Name: mtn-btuF-yadS         
Operon arrangement:
Transcription unit        Promoter
mnt-btuF-yadS
mnt-btuF-yadS


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yadSp6 177700 reverse Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter yadSp7 177757 reverse Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter yadSp5 177786 reverse Similarity to the consensus
Read more >
[ICWHO] [3]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Cadieux N., Bradbeer C., Reeger-Schneider E., Koster W., Mohanty AK., Wiener MC., Kadner RJ., 2002, Identification of the periplasmic cobalamin-binding protein BtuF of Escherichia coli., J Bacteriol 184(3):706-17

 [2] Jindal S., Yang L., Day PJ., Kell DB., 2019, Involvement of multiple influx and efflux transporters in the accumulation of cationic fluorescent dyes by Escherichia coli., BMC Microbiol 19(1):195

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB