RegulonDB RegulonDB 10.9: Gene Form
   

btuF gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

dgt btuF mtn yadS CpxR dgtp2 dgtp2 dgtp1 dgtp1 mtnp mtnp TSS_302 TSS_302 TSS_301 TSS_301 yadSp5 yadSp5 yadSp7 yadSp7 yadSp6 yadSp6

Gene      
Name: btuF    Texpresso search in the literature
Synonym(s): ECK0157, EG12334, b0158, yadT
Genome position(nucleotides): 177662 <-- 178462 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.93
Reference(s): [1] Cadieux N., et al., 2002
External database links:  
ASAP:
ABE-0000542
ECHOBASE:
EB2238
ECOLIHUB:
btuF
OU-MICROARRAY:
b0158
STRING:
511145.b0158
COLOMBOS: btuF


Product      
Name: vitamin B12 ABC transporter periplasmic binding protein
Synonym(s): BtuF, YadT
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space
Molecular weight: 29.367
Isoelectric point: 9.063
Motif(s):
 
Type Positions Sequence
66 -> 66 W
26 -> 217 VITLSPANTELAFAAGITPVGVSSYSDYPPQAQKIEQVSTWQGMNLERIVALKPDLVIAWRGGNAERQVDQLASLGIKVMWVDATSIEQIANALRQLAPWSPQPDKAEQAAQSLLDQYAQLKAQYADKPKKRVFLQFGINPPFTSGKESIQNQVLEVCGGENIFKDSRVPWPQVSREQVLARSPQAIVITGG
208 -> 208 S
23 -> 266 APRVITLSPANTELAFAAGITPVGVSSYSDYPPQAQKIEQVSTWQGMNLERIVALKPDLVIAWRGGNAERQVDQLASLGIKVMWVDATSIEQIANALRQLAPWSPQPDKAEQAAQSLLDQYAQLKAQYADKPKKRVFLQFGINPPFTSGKESIQNQVLEVCGGENIFKDSRVPWPQVSREQVLARSPQAIVITGGPDQIPKIKQYWGEQLKIPVIPLTSDWFERASPRIILAAQQLCNALSQVD
25 -> 266 RVITLSPANTELAFAAGITPVGVSSYSDYPPQAQKIEQVSTWQGMNLERIVALKPDLVIAWRGGNAERQVDQLASLGIKVMWVDATSIEQIANALRQLAPWSPQPDKAEQAAQSLLDQYAQLKAQYADKPKKRVFLQFGINPPFTSGKESIQNQVLEVCGGENIFKDSRVPWPQVSREQVLARSPQAIVITGGPDQIPKIKQYWGEQLKIPVIPLTSDWFERASPRIILAAQQLCNALSQVD

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.p - ABC superfamily, periplasmic binding component
Gene Ontology Terms (GO)  
cellular_component GO:0030288 - outer membrane-bounded periplasmic space
GO:0042597 - periplasmic space
molecular_function GO:0005515 - protein binding
GO:0031419 - cobalamin binding
biological_process GO:0015889 - cobalamin transport
Note(s): Note(s): ...[more].
Reference(s): [2] Borths EL., et al., 2002
[1] Cadieux N., et al., 2002
[3] Kandt C., et al., 2006
[4] Karpowich NK., et al., 2003
[5] Liu M., et al., 2008
[6] Serres MH., et al., 2001
External database links:  
DIP:
DIP-11194N
DISPROT:
DP02169
ECOCYC:
EG12334-MONOMER
ECOLIWIKI:
b0158
INTERPRO:
IPR023544
INTERPRO:
IPR002491
MINT:
P37028
MODBASE:
P37028
PDB:
5M3B
PDB:
5OVW
PDB:
5M34
PDB:
5M2Q
PDB:
5M29
PDB:
4FI3
PDB:
4DBL
PDB:
2QI9
PDB:
1N4D
PDB:
1N4A
PDB:
1N2Z
PFAM:
PF01497
PRIDE:
P37028
PRODB:
PRO_000022238
PROSITE:
PS50983
REFSEQ:
NP_414700
SMR:
P37028
UNIPROT:
P37028


Operon      
Name: mtn-btuF-yadS         
Operon arrangement:
Transcription unit        Promoter
mnt-btuF-yadS
mnt-btuF-yadS


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yadSp6 177700 reverse Similarity to the consensus
Read more >
[ICWHO] [7]
  promoter yadSp7 177757 reverse Similarity to the consensus
Read more >
[ICWHO] [7]
  promoter yadSp5 177786 reverse Similarity to the consensus
Read more >
[ICWHO] [7]
  promoter TSS_301 178744 reverse nd [RS-EPT-CBR] [8]
  promoter TSS_302 179181 reverse nd [RS-EPT-CBR] [8]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Cadieux N., Bradbeer C., Reeger-Schneider E., Koster W., Mohanty AK., Wiener MC., Kadner RJ., 2002, Identification of the periplasmic cobalamin-binding protein BtuF of Escherichia coli., J Bacteriol 184(3):706-17

 [2] Borths EL., Locher KP., Lee AT., Rees DC., 2002, The structure of Escherichia coli BtuF and binding to its cognate ATP binding cassette transporter., Proc Natl Acad Sci U S A 99(26):16642-7

 [3] Kandt C., Xu Z., Tieleman DP., 2006, Opening and closing motions in the periplasmic vitamin B12 binding protein BtuF., Biochemistry 45(44):13284-92

 [4] Karpowich NK., Huang HH., Smith PC., Hunt JF., 2003, Crystal structures of the BtuF periplasmic-binding protein for vitamin B12 suggest a functionally important reduction in protein mobility upon ligand binding., J Biol Chem 278(10):8429-34

 [5] Liu M., Sun T., Hu J., Chen W., Wang C., 2008, Study on the mechanism of the BtuF periplasmic-binding protein for vitamin B12., Biophys Chem 135(1-3):19-24

 [6] Serres MH., Gopal S., Nahum LA., Liang P., Gaasterland T., Riley M., 2001, A functional update of the Escherichia coli K-12 genome., Genome Biol 2(9):RESEARCH0035

 [7] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [8] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB