RegulonDB RegulonDB 10.9: Gene Form
   

yaeH gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

cdaR yaeI yaeH b0165 TSS_308 TSS_308 TSS_307 TSS_307

Gene      
Name: yaeH    Texpresso search in the literature
Synonym(s): ECK0162, EG12336, b0163
Genome position(nucleotides): 183709 <-- 184095 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
44.44
External database links:  
ASAP:
ABE-0000556
ECHOBASE:
EB2240
ECOLIHUB:
yaeH
OU-MICROARRAY:
b0163
STRING:
511145.b0163
COLOMBOS: yaeH


Product      
Name: DUF3461 domain-containing protein YaeH
Synonym(s): YaeH
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 15.096
Isoelectric point: 7.351
Motif(s):
 
Type Positions Sequence
1 -> 125 MYDNLKSLGITNPEEIDRYSLRQEANNDILKIYFQKDKGEFFAKSVKFKYPRQRKTVVADGVGQGYKEVQEISPNLRYIIDELDQICQRDRSEVDLKRKILDDLRHLESVVTNKISEIEADLEKL

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-48129N
ECOCYC:
EG12336-MONOMER
ECOLIWIKI:
b0163
INTERPRO:
IPR020911
PFAM:
PF11944
PRIDE:
P62768
REFSEQ:
NP_414705
SMR:
P62768
UNIPROT:
P62768


Operon      
Name: yaeH         
Operon arrangement:
Transcription unit        Promoter
yaeH


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_307 183840 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_308 184193 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB