RegulonDB RegulonDB 10.8: Gene Form
   

yaeI gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

dapD yaeI yaeH b0165 anti-anti-terminator anti-terminator terminator TSS_308 TSS_308 TSS_307 TSS_307

Gene      
Name: yaeI    Texpresso search in the literature
Synonym(s): ECK0163, EG12337, b0164
Genome position(nucleotides): 184257 <-- 185069 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.41
External database links:  
ASAP:
ABE-0000559
ECHOBASE:
EB2241
OU-MICROARRAY:
b0164
PortEco:
yaeI
STRING:
511145.b0164
COLOMBOS: yaeI


Product      
Name: phosphodiesterase YaeI
Synonym(s): YaeI
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 29.863
Isoelectric point: 6.59
Motif(s):
 
Type Positions Sequence
49 -> 211 FKILFLADLHYSRFVPLSLISDAIALGIEQKPDLILLGGDYVLFDMSLNFSAFSDVLSPLAECAPTFACFGNHDRPVGTEKNHLIGETLKSAGITVLFNQATVIATPNRQFELVGTGDLWAGQCKPPPASEANLPRLVLAHNPDSKEVMRDEPWDLMLCGHTH

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
molecular_function GO:0016787 - hydrolase activity
GO:0046872 - metal ion binding
GO:0008081 - phosphoric diester hydrolase activity
GO:0008758 - UDP-2,3-diacylglucosamine hydrolase activity
biological_process GO:0009245 - lipid A biosynthetic process
Note(s): Note(s): ...[more].
Evidence: [APPH] Assay of protein purified to homogeneity
Reference(s): [1] Kuznetsova E., et al., 2005
External database links:  
ECOCYC:
EG12337-MONOMER
ECOLIWIKI:
b0164
INTERPRO:
IPR004843
INTERPRO:
IPR029052
MODBASE:
P37049
PFAM:
PF00149
PRIDE:
P37049
REFSEQ:
NP_414706
SMR:
P37049
UNIPROT:
P37049


Operon      
Name: yaeI         
Operon arrangement:
Transcription unit        Promoter
 


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_307 183840 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_308 184193 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Kuznetsova E., Proudfoot M., Sanders SA., Reinking J., Savchenko A., Arrowsmith CH., Edwards AM., Yakunin AF., 2005, Enzyme genomics: Application of general enzymatic screens to discover new enzymes., FEMS Microbiol Rev 29(2):263-79

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB