RegulonDB RegulonDB 10.8: Gene Form
   

afuC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

afuC mmuM insAB2 insB2 afuB insA2 mmuP TSS_467 (cluster) TSS_467 (cluster)

Gene      
Name: afuC    Texpresso search in the literature
Synonym(s): ECK0264, EG12340, b0262, fbpC, yagC
Genome position(nucleotides): 277756 <-- 278802 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.35
External database links:  
ASAP:
ABE-0000898
ECHOBASE:
EB2244
OU-MICROARRAY:
b0262
PortEco:
afuC
STRING:
511145.b0262
COLOMBOS: afuC


Product      
Name: CP4-6 prophage; ABC transporter ATP-binding protein AfuC
Synonym(s): AfuC, FbpC, YagC
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane,cytosol
Molecular weight: 39.059
Isoelectric point: 6.046
Motif(s):
 
Type Positions Sequence
7 -> 237 VELRNVTKRFGSNTVIDNINLTIPQGQMVTLLGPSGCGKTTILRLVAGLEKPSEGQIFIDGEDVTHRSIQQRDICMVFQSYALFPHMSLGENVGYGLKMLGVPRAELKARVKEALAMVDLEGFEDRFVDQISGGQQQRVALARALILKPKVLLFDEPLSNLDANLRRSMRDKIRELQKQFDITSLYVTHDQSEAFAVSDTVLVMNKGHIMQIGSPQDLYRQPASRFMASFM
39 -> 46 GPSGCGKT
23 -> 164 DNINLTIPQGQMVTLLGPSGCGKTTILRLVAGLEKPSEGQIFIDGEDVTHRSIQQRDICMVFQSYALFPHMSLGENVGYGLKMLGVPRAELKARVKEALAMVDLEGFEDRFVDQISGGQQQRVALARALILKPKVLLFDEPL
273 -> 344 VGVRPEAITLSDRGEESQRCVIRHVAYMGPQYEVTVEWHGQEILLQVNATRLQPDVGEQYYLEIHPYGMFVL

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases
Gene Ontology Terms (GO)  
cellular_component GO:0005623 - cell
GO:0005829 - cytosol
GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0043190 - ATP-binding cassette (ABC) transporter complex
molecular_function GO:0016887 - ATPase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0022857 - transmembrane transporter activity
GO:0015408 - ATPase-coupled ferric iron transmembrane transporter activity
biological_process GO:0006811 - ion transport
GO:0006826 - iron ion transport
GO:0055072 - iron ion homeostasis
GO:0055085 - transmembrane transport
GO:0034755 - iron ion transmembrane transport
GO:0033212 - iron import into cell
GO:0072512 - trivalent inorganic cation transport
Note(s): Note(s): ...[more].
Evidence: [AIFS] Automated inference of function from sequence
Reference(s): [1] Riley M., et al., 2006
External database links:  
DIP:
DIP-9064N
ECOCYC:
YAGC-MONOMER
ECOLIWIKI:
b0262
INTERPRO:
IPR008995
INTERPRO:
IPR027417
INTERPRO:
IPR017871
INTERPRO:
IPR015853
INTERPRO:
IPR013611
INTERPRO:
IPR003593
INTERPRO:
IPR003439
MINT:
MINT-1316081
MODBASE:
P37009
PFAM:
PF00005
PFAM:
PF08402
PRIDE:
P37009
PRODB:
PRO_000022577
PROSITE:
PS00211
PROSITE:
PS51242
PROSITE:
PS50893
REFSEQ:
NP_414796
SMART:
SM00382
SMR:
P37009
SWISSMODEL:
P37009
UNIPROT:
P37009


Operon      
Name: insAB2A2B2-afuBC         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Riley M., Abe T., Arnaud MB., Berlyn MK., Blattner FR., Chaudhuri RR., Glasner JD., Horiuchi T., Keseler IM., Kosuge T., Mori H., Perna NT., Plunkett G., Rudd KE., Serres MH., Thomas GH., Thomson NR., Wishart D., Wanner BL., 2006, Escherichia coli K-12: a cooperatively developed annotation snapshot--2005., Nucleic Acids Res 34(1):1-9


RegulonDB