RegulonDB RegulonDB 10.8: Gene Form
   

intE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

intE lit ymfH xisE terminator TSS_1491 TSS_1491

Gene      
Name: intE    Texpresso search in the literature
Synonym(s): ECK1126, EG12370, b1140, int(Lambda), ycfI
Genome position(nucleotides): 1199679 <-- 1200806 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
44.77
External database links:  
ASAP:
ABE-0003836
ECHOBASE:
EB2273
OU-MICROARRAY:
b1140
PortEco:
intE
STRING:
511145.b1140
COLOMBOS: intE


Product      
Name: e14 prophage; putative integrase
Synonym(s): IntE, YcfI
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 42.799
Isoelectric point: 10.628
Motif(s):
 
Type Positions Sequence
189 -> 375 ITRQRLSLEEWKKIFDIADATHRYMGNAMLLALVTGQRLGDISRMKFSDIWDDHLHVIQEKTGSKIAIPLSLRLNAINWSLRDVVARCRDYAVSAYLVHFFRSTSQAERGAQVKANTLTMNFSKARDLARIDWGEGSPATFHEQRSLSERLYKEQGLDTQKLLGHKTQQQTDRYHDDRGKGWSKVAL
1 -> 72 MAARPRKNNVSVPNLYPLYSRKVNKVYWRYKHPVTGKFHALGTNEAEAIAIATEANTRLAEQRTRQILAISD
82 -> 167 ITTSTWLDRYQAIQDDRLKSGDIRLNTYKQKAKPVSLLRERAGMKLISAVDVRDIAQLLDEYIAAGRPRMAQVVRSVLIDVFKEAQ
193 -> 364 RLSLEEWKKIFDIADATHRYMGNAMLLALVTGQRLGDISRMKFSDIWDDHLHVIQEKTGSKIAIPLSLRLNAINWSLRDVVARCRDYAVSAYLVHFFRSTSQAERGAQVKANTLTMNFSKARDLARIDWGEGSPATFHEQRSLSERLYKEQGLDTQKLLGHKTQQQTDRYHD

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0008907 - integrase activity
GO:0046982 - protein heterodimerization activity
biological_process GO:0044826 - viral genome integration into host DNA
GO:0006310 - DNA recombination
GO:0015074 - DNA integration
GO:0046718 - viral entry into host cell
GO:0075713 - establishment of integrated proviral latency
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-10037N
ECOCYC:
EG12370-MONOMER
ECOLIWIKI:
b1140
INTERPRO:
IPR011010
INTERPRO:
IPR016177
INTERPRO:
IPR015094
INTERPRO:
IPR013762
INTERPRO:
IPR010998
INTERPRO:
IPR002104
MINT:
MINT-1262950
MODBASE:
P75969
PFAM:
PF09003
PFAM:
PF00589
PRIDE:
P75969
PRODB:
PRO_000023027
PROSITE:
PS51900
PROSITE:
PS51898
REFSEQ:
NP_415658
SMR:
P75969
UNIPROT:
P75969


Operon      
Name: ymfH-xisE-intE         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1491 1201113 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB