RegulonDB RegulonDB 11.0: Gene Form

ydiE gene in Escherichia coli K-12 genome

Gene local context to scale (view description)

selO aroH ydiE ydiEp5 ydiEp5 TSS_1995 TSS_1995

Name: ydiE    Texpresso search in the literature
Synonym(s): ECK1703, EG12391, b1705
Genome position(nucleotides): 1789613 --> 1789804
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
External database links:  

Name: PF10636 family protein YdiE
Synonym(s): YdiE
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 7.117
Isoelectric point: 10.379
Type Positions Sequence Comment
1 -> 32 MRYTDSRKLTPETDANHKTASPQPIRRISSQT UniProt: Disordered; Sequence Annotation Type: region of interest.
15 -> 30 ANHKTASPQPIRRISS UniProt: Polar residues; Sequence Annotation Type: compositionally biased region.


Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
molecular_function GO:0042803 - protein homodimerization activity
External database links:  

Name: ydiE         
Operon arrangement:
Transcription unit        Promoter

Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1995 1789271 forward nd [RS-EPT-CBR] [1]
  promoter ydiEp5 1789603 forward nd [ICWHO] [2]


 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight


 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78
