RegulonDB RegulonDB 10.9: Gene Form
   

msrB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

gapA msrB yeaC Cra CRP Cra anti-terminator anti-anti-terminator TSS_2117 TSS_2117 TSS_2116 (cluster) TSS_2116 (cluster) TSS_2115 TSS_2115 TSS_2114 TSS_2114 TSS_2113 TSS_2113 TSS_2112 (cluster) TSS_2112 (cluster) TSS_2111 (cluster) TSS_2111 (cluster) TSS_2110 TSS_2110 TSS_2109 TSS_2109 TSS_2108 TSS_2108 TSS_2107 TSS_2107 TSS_2106 (cluster) TSS_2106 (cluster) TSS_2105 TSS_2105 TSS_2104 TSS_2104 TSS_2103 (cluster) TSS_2103 (cluster) TSS_2102 TSS_2102 TSS_2101 TSS_2101 TSS_2100 TSS_2100 TSS_2099 TSS_2099 TSS_2098 TSS_2098 TSS_2097 TSS_2097 TSS_2096 TSS_2096 TSS_2095 (cluster) TSS_2095 (cluster) TSS_2094 TSS_2094 TSS_2093 (cluster) TSS_2093 (cluster) TSS_2092 TSS_2092 TSS_2091 TSS_2091 TSS_2090 TSS_2090 TSS_2089 TSS_2089 TSS_2088 TSS_2088 TSS_2087 (cluster) TSS_2087 (cluster) TSS_2086 (cluster) TSS_2086 (cluster) TSS_2085 TSS_2085 TSS_2084 TSS_2084 TSS_2083 TSS_2083 TSS_2082 (cluster) TSS_2082 (cluster) TSS_2081 (cluster) TSS_2081 (cluster) gapAp1 gapAp1 gapAp2 gapAp2 gapAp3 gapAp3 msrBp5 msrBp5 gapAp4 gapAp4 msrBp6 msrBp6 gapAp6 gapAp6 gapAp7 gapAp7

Gene      
Name: msrB    Texpresso search in the literature
Synonym(s): ECK1776, EG12394, b1778, yeaA
Genome position(nucleotides): 1862016 <-- 1862429 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.55
Reference(s): [1] Grimaud R., et al., 2001
External database links:  
ASAP:
ABE-0005916
ECHOBASE:
EB2295
ECOLIHUB:
msrB
MIM:
613718
OU-MICROARRAY:
b1778
STRING:
511145.b1778
COLOMBOS: msrB


Product      
Name: methionine sulfoxide reductase B
Synonym(s): MsrB, YeaA
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 15.451
Isoelectric point: 5.855
Motif(s):
 
Type Positions Sequence
7 -> 129 AEELKKNLSEMQFYVTQNHGTEPPFTGRLLHNKRDGVYHCLICDAPLFHSQTKYDSGCGWPSFYEPVSEESIRYIKDLSHGMQRIEIRCGNCDAHLGHVFPDGPQPTGERYCVNSASLRFTDG
98 -> 98 C
9 -> 127 ELKKNLSEMQFYVTQNHGTEPPFTGRLLHNKRDGVYHCLICDAPLFHSQTKYDSGCGWPSFYEPVSEESIRYIKDLSHGMQRIEIRCGNCDAHLGHVFPDGPQPTGERYCVNSASLRFT
49 -> 49 C
2 -> 137 ANKPSAEELKKNLSEMQFYVTQNHGTEPPFTGRLLHNKRDGVYHCLICDAPLFHSQTKYDSGCGWPSFYEPVSEESIRYIKDLSHGMQRIEIRCGNCDAHLGHVFPDGPQPTGERYCVNSASLRFTDGENGEEING

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.4 - chaperoning, repair (refolding)
  5 - cell processes --> 5.5 - adaptations --> 5.5.6 - other (mechanical, nutritional, oxidative stress)
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0046872 - metal ion binding
GO:0016491 - oxidoreductase activity
GO:0008270 - zinc ion binding
GO:0016671 - oxidoreductase activity, acting on a sulfur group of donors, disulfide as acceptor
GO:0005506 - iron ion binding
GO:0033743 - peptide-methionine (R)-S-oxide reductase activity
GO:0033745 - L-methionine-(R)-S-oxide reductase activity
biological_process GO:0006979 - response to oxidative stress
GO:0030091 - protein repair
GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
Reference(s): [2] Brot N., et al., 1981
[3] Levine RL., et al., 1999
External database links:  
DIP:
DIP-48167N
ECOCYC:
EG12394-MONOMER
ECOLIWIKI:
b1778
INTERPRO:
IPR028427
INTERPRO:
IPR002579
INTERPRO:
IPR011057
MODBASE:
P0A746
PANTHER:
PTHR10173
PFAM:
PF01641
PRIDE:
P0A746
PRODB:
PRO_000023299
PROSITE:
PS51790
REFSEQ:
NP_416292
SWISSMODEL:
P0A746
UNIPROT:
P0A746


Operon      
Name: msrB         
Operon arrangement:
Transcription unit        Promoter
msrB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter msrBp5 1862584 reverse Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter TSS_2081 (cluster) 1862738 forward For this promoter, there
Read more >
[RS-EPT-CBR] [5]
  promoter TSS_2082 (cluster) 1862743 forward For this promoter, there
Read more >
[RS-EPT-CBR] [5]
  promoter TSS_2083 1862751 forward nd [RS-EPT-CBR] [5]
  promoter TSS_2084 1862755 forward nd [RS-EPT-CBR] [5]
  promoter TSS_2085 1862771 forward nd [RS-EPT-CBR] [5]
  promoter TSS_2086 (cluster) 1862774 forward For this promoter, there
Read more >
[RS-EPT-CBR] [5]
  promoter TSS_2087 (cluster) 1862788 forward For this promoter, there
Read more >
[RS-EPT-CBR] [5]
  promoter TSS_2088 1862797 forward nd [RS-EPT-CBR] [5]
  promoter TSS_2089 1862804 forward nd [RS-EPT-CBR] [5]
  promoter TSS_2090 1862847 forward nd [RS-EPT-CBR] [5]
  promoter TSS_2091 1862947 forward nd [RS-EPT-CBR] [5]
  promoter TSS_2092 1862959 forward nd [RS-EPT-CBR] [5]
  promoter TSS_2093 (cluster) 1862961 forward For this promoter, there
Read more >
[RS-EPT-CBR] [5]
  promoter TSS_2094 1863001 forward nd [RS-EPT-CBR] [5]
  promoter TSS_2095 (cluster) 1863006 forward For this promoter, there
Read more >
[RS-EPT-CBR] [5]
  promoter TSS_2096 1863012 forward nd [RS-EPT-CBR] [5]
  promoter TSS_2097 1863021 forward nd [RS-EPT-CBR] [5]
  promoter TSS_2098 1863027 forward nd [RS-EPT-CBR] [5]
  promoter TSS_2099 1863087 forward nd [RS-EPT-CBR] [5]
  promoter TSS_2100 1863184 forward nd [RS-EPT-CBR] [5]
  promoter TSS_2101 1863237 forward nd [RS-EPT-CBR] [5]
  promoter TSS_2102 1863241 forward nd [RS-EPT-CBR] [5]
  promoter TSS_2103 (cluster) 1863253 forward For this promoter, there
Read more >
[RS-EPT-CBR] [5]
  promoter TSS_2104 1863264 forward nd [RS-EPT-CBR] [5]
  promoter TSS_2105 1863314 forward nd [RS-EPT-CBR] [5]
  promoter TSS_2106 (cluster) 1863369 forward For this promoter, there
Read more >
[RS-EPT-CBR] [5]
  promoter TSS_2107 1863446 forward nd [RS-EPT-CBR] [5]
  promoter TSS_2108 1863455 forward nd [RS-EPT-CBR] [5]
  promoter TSS_2109 1863467 forward nd [RS-EPT-CBR] [5]
  promoter TSS_2110 1863477 forward nd [RS-EPT-CBR] [5]
  promoter TSS_2111 (cluster) 1863480 forward For this promoter, there
Read more >
[RS-EPT-CBR] [5]
  promoter TSS_2112 (cluster) 1863483 forward For this promoter, there
Read more >
[RS-EPT-CBR] [5]
  promoter TSS_2113 1863495 forward nd [RS-EPT-CBR] [5]
  promoter TSS_2114 1863581 forward nd [RS-EPT-CBR] [5]
  promoter TSS_2115 1863598 forward nd [RS-EPT-CBR] [5]
  promoter TSS_2116 (cluster) 1863618 forward For this promoter, there
Read more >
[RS-EPT-CBR] [5]
  promoter TSS_2117 1863646 forward nd [RS-EPT-CBR] [5]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Grimaud R., Ezraty B., Mitchell JK., Lafitte D., Briand C., Derrick PJ., Barras F., 2001, Repair of oxidized proteins. Identification of a new methionine sulfoxide reductase., J Biol Chem 276(52):48915-20

 [2] Brot N., Weissbach L., Werth J., Weissbach H., 1981, Enzymatic reduction of protein-bound methionine sulfoxide., Proc Natl Acad Sci U S A 78(4):2155-8

 [3] Levine RL., Berlett BS., Moskovitz J., Mosoni L., Stadtman ER., 1999, Methionine residues may protect proteins from critical oxidative damage., Mech Ageing Dev 107(3):323-32

 [4] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [5] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB