RegulonDB RegulonDB 10.9: Gene Form
   

ybiJ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ybiI ybiJ ybiE

Gene      
Name: ybiJ    Texpresso search in the literature
Synonym(s): ECK0791, EG12422, b0802
Genome position(nucleotides): 837665 <-- 837925 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.57
External database links:  
ASAP:
ABE-0002741
ECHOBASE:
EB2321
ECOLIHUB:
ybiJ
OU-MICROARRAY:
b0802
STRING:
511145.b0802
COLOMBOS: ybiJ


Product      
Name: DUF1471 domain-containing protein YbiJ
Synonym(s): YbiJ
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space
Molecular weight: 8.568
Isoelectric point: 9.048
Motif(s):
 
Type Positions Sequence
23 -> 86 AEPVTASQAQNMNKIGVVSADGASTLDALEAKLAEKAAAAGASGYSITSATNNNKLSGTAVIYK
1 -> 22 MKTINTVVAAMALSTLSFGVFA
34 -> 86 MNKIGVVSADGASTLDALEAKLAEKAAAAGASGYSITSATNNNKLSGTAVIYK

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0042597 - periplasmic space
biological_process GO:0006974 - cellular response to DNA damage stimulus
Note(s): Note(s): ...[more].
Reference(s): [1] Paradis-Bleau C., et al., 2014
External database links:  
ECOCYC:
EG12422-MONOMER
ECOLIWIKI:
b0802
INTERPRO:
IPR025543
INTERPRO:
IPR036275
INTERPRO:
IPR010854
PFAM:
PF07338
PRIDE:
P0AAX3
REFSEQ:
NP_415323
SMR:
P0AAX3
UNIPROT:
P0AAX3


Operon      
Name: ybiJ         
Operon arrangement:
Transcription unit        Promoter
ybiJ


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Paradis-Bleau C., Kritikos G., Orlova K., Typas A., Bernhardt TG., 2014, A genome-wide screen for bacterial envelope biogenesis mutants identifies a novel factor involved in cell wall precursor metabolism., PLoS Genet 10(1):e1004056


RegulonDB