RegulonDB RegulonDB 10.9: Gene Form
   

rluB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yciQ rluB btuR yciK terminator TSS_1708 TSS_1708 TSS_1707 TSS_1707 TSS_1706 TSS_1706 TSS_1705 TSS_1705 TSS_1704 (cluster) TSS_1704 (cluster) TSS_1703 (cluster) TSS_1703 (cluster)

Gene      
Name: rluB    Texpresso search in the literature
Synonym(s): ECK1263, EG12433, b1269, yciL
Genome position(nucleotides): 1326852 --> 1327727 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.77
External database links:  
ASAP:
ABE-0004259
ECHOBASE:
EB2329
ECOLIHUB:
rluB
OU-MICROARRAY:
b1269
STRING:
511145.b1269
COLOMBOS: rluB


Product      
Name: 23S rRNA pseudouridine2605 synthase
Synonym(s): RluB, YciL, ribosomal large subunit pseudouridine synthase B
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 32.711
Isoelectric point: 10.613
Motif(s):
 
Type Positions Sequence
4 -> 43 KLQKVLARAGHGSRREIESIIEAGRVSVDGKIAKLGDRVE
3 -> 75 EKLQKVLARAGHGSRREIESIIEAGRVSVDGKIAKLGDRVEVTPGLKIRIDGHLISVRESAEQICRVLAYYKP
69 -> 199 VLAYYKPEGELCTRNDPEGRPTVFDRLPKLRGARWIAVGRLDVNTCGLLLFTTDGELANRLMHPSREVEREYAVRVFGQVDDAKLRDLSRGVQLEDGPAAFKTIKFSGGEGINQWYNVTLTEGRNREVRRL
110 -> 110 D

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.3 - RNA modification
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0120159 - rRNA pseudouridine synthase activity
GO:0005515 - protein binding
GO:0016853 - isomerase activity
GO:0016866 - intramolecular transferase activity
GO:0003723 - RNA binding
GO:0009982 - pseudouridine synthase activity
biological_process GO:0009451 - RNA modification
GO:0001522 - pseudouridine synthesis
GO:0006364 - rRNA processing
GO:0000455 - enzyme-directed rRNA pseudouridine synthesis
Note(s): Note(s): ...[more].
Reference(s): [1] Gustafsson C., et al., 1996
External database links:  
DIP:
DIP-11585N
ECOCYC:
EG12433-MONOMER
ECOLIWIKI:
b1269
INTERPRO:
IPR000748
INTERPRO:
IPR020103
INTERPRO:
IPR036986
INTERPRO:
IPR002942
INTERPRO:
IPR006145
INTERPRO:
IPR018496
MODBASE:
P37765
PDB:
4LGT
PDB:
4LAB
PFAM:
PF01479
PFAM:
PF00849
PRIDE:
P37765
PRODB:
PRO_000023777
PROSITE:
PS01149
PROSITE:
PS50889
REFSEQ:
NP_415785
SMART:
SM00363
SMR:
P37765
UNIPROT:
P37765


Operon      
Name: rluB         
Operon arrangement:
Transcription unit        Promoter
rluB


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1703 (cluster) 1326296 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_1704 (cluster) 1326918 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_1705 1326921 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1706 1326973 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1707 1326992 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1708 1327047 forward nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Gustafsson C., Reid R., Greene PJ., Santi DV., 1996, Identification of new RNA modifying enzymes by iterative genome search using known modifying enzymes as probes., Nucleic Acids Res 24(19):3756-62

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB