RegulonDB RegulonDB 10.9: Gene Form
   

ygiM gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ygiF cca ygiM TSS_3365 TSS_3365 ygiMp ygiMp ygiMp2 ygiMp2 TSS_3364 TSS_3364 TSS_3363 (cluster) TSS_3363 (cluster) glnEp6 glnEp6 glnEp5 glnEp5 glnEp1 glnEp1 glnEp7 glnEp7

Gene      
Name: ygiM    Texpresso search in the literature
Synonym(s): ECK3045, EG12434, b3055, ecfG, htrG
Genome position(nucleotides): 3201207 --> 3201827 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.66
External database links:  
ASAP:
ABE-0010028
ECHOBASE:
EB2330
ECOLIHUB:
htrG
OU-MICROARRAY:
b3055
STRING:
511145.b3055
COLOMBOS: ygiM


Product      
Name: putative signal transduction protein (SH3 domain)
Synonym(s): EcfG, HtrG, YgiM
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol,inner membrane
Molecular weight: 23.076
Isoelectric point: 9.677
Motif(s):
 
Type Positions Sequence
1 -> 22 MPKLRLIGLTLLALSATAVSHA
35 -> 81 WVRSGPGDHYRLVGTVNAGEEVTLLQTDANTNYAQVKDSSGRTAWIP
23 -> 206 EETRYVSDELNTWVRSGPGDHYRLVGTVNAGEEVTLLQTDANTNYAQVKDSSGRTAWIPLKQLSTEPSLRSRVPDLENQVKTLTDKLTNIDNTWNQRTAEMQQKVAQSDSVINGLKEENQKLKNELIVAQKKVDAASVQLDDKQRTIIMQWFMYGGGVLGLGLLLGLVLPHLIPSRKRKDRWMN
169 -> 191 IIMQWFMYGGGVLGLGLLLGLVL

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0016020 - membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG12434-MONOMER
ECOLIWIKI:
b3055
INTERPRO:
IPR003646
INTERPRO:
IPR016476
PFAM:
PF08239
PRIDE:
P0ADT8
PROSITE:
PS51781
REFSEQ:
NP_417527
SMART:
SM00287
UNIPROT:
P0ADT8


Operon      
Name: ygiM-cca         
Operon arrangement:
Transcription unit        Promoter
htrG-cca
ygiM


Regulation by small RNA    
  Display Regulation
small RNA micA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter glnEp7 3199694 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter glnEp1 3199698 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter glnEp5 3199753 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter glnEp6 3199801 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_3363 (cluster) 3201032 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_3364 3201036 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3365 3201334 forward nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB