RegulonDB RegulonDB 10.9: Gene Form
   

menE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

menE menC menB pmrD arnF pmrDp3 pmrDp3 pmrDp4 pmrDp4

Gene      
Name: menE    Texpresso search in the literature
Synonym(s): ECK2254, EG12437, b2260
Genome position(nucleotides): 2373648 <-- 2375003 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.05
External database links:  
ASAP:
ABE-0007471
CGSC:
17653
ECHOBASE:
EB2332
ECOLIHUB:
menE
OU-MICROARRAY:
b2260
STRING:
511145.b2260
COLOMBOS: menE


Product      
Name: o-succinylbenzoate—CoA ligase
Synonym(s): MenE
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 50.185
Isoelectric point: 6.376
Motif(s):
 
Type Positions Sequence
382 -> 382 I
366 -> 423 EVERVIAAHPAVLQVFIVPVADKEFGHRPVAVMEYDHESVDLSEWVKDKLARFQQPVR
13 -> 355 QVRGETIALRLNDEQLNWRELCARVDELASGFAVQGVVEGSGVMLRAWNTPQTLLAWLALLQCGARVLPVNPQLPQPLLEELLPNLTLQFALVPDGENTFPALTSLHIQLVEGAHAATWQPTRLCSMTLTSGSTGLPKAAVHTYQAHLASAQGVLSLIPFGDHDDWLLSLPLFHVSGQGIMWRWLYAGARMTVRDKQPLEQMLAGCTHASLVPTQLWRLLVNRSSVSLKAVLLGGAAIPVELTEQAREQGIRCFCGYGLTEFASTVCAKEADGLADVGSPLPGREVKIVNNEVWLRAASMAEGYWRNGQLVSLVNDEGWYATRDRGEMHNGKLTIVGRLDNLF

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.7 - anaerobic respiration
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.3 - cofactors, small molecule carriers --> 1.5.3.11 - menaquinone, ubiquinone
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0032991 - protein-containing complex
molecular_function GO:0016874 - ligase activity
GO:0008756 - o-succinylbenzoate-CoA ligase activity
GO:0016405 - CoA-ligase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0042802 - identical protein binding
biological_process GO:0009234 - menaquinone biosynthetic process
Note(s): Note(s): ...[more].
Reference(s): [1] Lu X., et al., 2008
External database links:  
DIP:
DIP-10186N
ECOCYC:
O-SUCCINYLBENZOATE-COA-LIG-MONOMER
ECOLIWIKI:
b2260
INTERPRO:
IPR025110
INTERPRO:
IPR000873
INTERPRO:
IPR010192
INTERPRO:
IPR020845
INTERPRO:
IPR042099
MODBASE:
P37353
PDB:
6NJ0
PDB:
5C5H
PFAM:
PF00501
PFAM:
PF13193
PRIDE:
P37353
PRODB:
PRO_000023204
PROSITE:
PS00455
REFSEQ:
NP_416763
SMR:
P37353
UNIPROT:
P37353


Operon      
Name: menFDHBCE         
Operon arrangement:
Transcription unit        Promoter
menD-yfbB-menBCE
menBCE
menFD-yfbB-menBCE


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter pmrDp4 2373566 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter pmrDp3 2373574 reverse Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Lu X., Zhang H., Tonge PJ., Tan DS., 2008, Mechanism-based inhibitors of MenE, an acyl-CoA synthetase involved in bacterial menaquinone biosynthesis., Bioorg Med Chem Lett 18(22):5963-6

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB