RegulonDB RegulonDB 10.9: Gene Form
   

mpl gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

mpl fbp yjgA Cra CRP TSS_5083 TSS_5083 mplp2 mplp2 mplp1 mplp1

Gene      
Name: mpl    Texpresso search in the literature
Synonym(s): ECK4228, EG12440, b4233, tpl, yjfG
Genome position(nucleotides): 4455785 --> 4457158 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.31
External database links:  
ASAP:
ABE-0013847
ECHOBASE:
EB2335
ECOLIHUB:
mpl
OU-MICROARRAY:
b4233
STRING:
511145.b4233
COLOMBOS: mpl


Shine dalgarno      
Sequence: agattaaaaaAGGATAgtgacgtATG


Product      
Name: UDP-N-acetylmuramate—L-alanyl-γ-D-glutamyl-meso-2,6-diaminoheptanedioate ligase
Synonym(s): Mpl, Tpl, YjfG
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol,extracellular space
Molecular weight: 49.874
Isoelectric point: 5.766
Motif(s):
 
Type Positions Sequence
108 -> 291 VAGTHGKTTTAGMATWILEQCGYKPGFVIGGVPGNFEVSAHLGESDFFVIEADEYDCAFFDKRSKFVHYCPRTLILNNLEFDHADIFDDLKAIQKQFHHLVRIVPGQGRIIWPENDINLKQTMAMGCWSEQELVGEQGHWQAKKLTTDASEWEVLLDGEKVGEVKWSLVGEHNMHNGLMAIAAA
110 -> 116 GTHGKTT
2 -> 101 RIHILGICGTFMGGLAMLARQLGHEVTGSDANVYPPMSTLLEKQGIELIQGYDASQLEPQPDLVIIGNAMTRGNPCVEAVLEKNIPYMSGPQWLHDFVLR
312 -> 361 RRRLELRGEANGVTVYDDFAHHPTAILATLAALRGKVGGTARIIAVLEPR

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.34 - murein turnover, recycling
  6 - cell structure --> 6.2 - murein
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:0005576 - extracellular region
molecular_function GO:0016874 - ligase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0016881 - acid-amino acid ligase activity
GO:0042802 - identical protein binding
biological_process GO:0000270 - peptidoglycan metabolic process
GO:0051301 - cell division
GO:0007049 - cell cycle
GO:0009058 - biosynthetic process
GO:0009252 - peptidoglycan biosynthetic process
GO:0009254 - peptidoglycan turnover
GO:0008360 - regulation of cell shape
GO:0071555 - cell wall organization
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-10246N
ECOCYC:
EG12440-MONOMER
ECOLIWIKI:
b4233
INTERPRO:
IPR013221
INTERPRO:
IPR036565
INTERPRO:
IPR005757
INTERPRO:
IPR036615
INTERPRO:
IPR000713
INTERPRO:
IPR004101
MODBASE:
P37773
PFAM:
PF01225
PFAM:
PF02875
PFAM:
PF08245
PRIDE:
P37773
PRODB:
PRO_000023277
REFSEQ:
NP_418654
SMR:
P37773
UNIPROT:
P37773


Operon      
Name: mpl         
Operon arrangement:
Transcription unit        Promoter
mpl
mpl
mpl


Transcriptional Regulation      
Display Regulation             
Activated by: CRP
Repressed by: Cra


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_5083 4455762 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB