RegulonDB RegulonDB 10.8: Gene Form
   

cycA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

cycA ytfE fklB GcvB TSS_5069 TSS_5069 TSS_5068 TSS_5068 TSS_5067 (cluster) TSS_5067 (cluster) cycAp cycAp TSS_5065 TSS_5065

Gene      
Name: cycA    Texpresso search in the literature
Synonym(s): ECK4204, EG12504, b4208, dagA, ytfD
Genome position(nucleotides): 4429864 --> 4431276 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.58
External database links:  
ASAP:
ABE-0013764
CGSC:
900
ECHOBASE:
EB2397
OU-MICROARRAY:
b4208
PortEco:
cycA
STRING:
511145.b4208
COLOMBOS: cycA


Product      
Name: D-serine/alanine/glycine/:H+symporter
Synonym(s): CycA, CycA APC transporter, DagA, YtfD
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 51.66
Isoelectric point: 8.946
Motif(s):
 
Type Positions Sequence
211 -> 231 LSGFFAGFQIAVFAFVGIELV
371 -> 391 AFTMITTVSAILFMFVWTIIL
51 -> 71 LAGPSIIFVYMIIGFMLFFVM
30 -> 50 LIAIGGAIGTGLFMGSGKTIS
27 -> 468 HIQLIAIGGAIGTGLFMGSGKTISLAGPSIIFVYMIIGFMLFFVMRAMGELLLSNLEYKSFSDFASDLLGPWAGYFTGWTYWFCWVVTGMADVVAITAYAQFWFPDLSDWVASLAVIVLLLTLNLATVKMFGEMEFWFAMIKIVAIVSLIVVGLVMVAMHFQSPTGVEASFAHLWNDGGWFPKGLSGFFAGFQIAVFAFVGIELVGTTAAETKDPEKSLPRAINSIPIRIIMFYVFALIVIMSVTPWSSVVPEKSPFVELFVLVGLPAAASVINFVVLTSAASSANSGVFSTSRMLFGLAQEGVAPKAFAKLSKRAVPAKGLTFSCICLLGGVVMLYVNPSVIGAFTMITTVSAILFMFVWTIILCSYLVYRKQRPHLHEKSIYKMPLGKLMCWVCMAFFVFVVVLLTLEDDTRQALLVTPLWFIALGLGWLFIGKKRAAEL

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.2 - Electrochemical potential driven transporters --> 4.2.A - Porters (Uni-, Sym- and Antiporters)
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0022857 - transmembrane transporter activity
GO:0001761 - beta-alanine transmembrane transporter activity
GO:0015180 - L-alanine transmembrane transporter activity
GO:0015187 - glycine transmembrane transporter activity
GO:0042944 - D-alanine transmembrane transporter activity
GO:0042945 - D-serine transmembrane transporter activity
biological_process GO:0006865 - amino acid transport
GO:0055085 - transmembrane transport
GO:0001762 - beta-alanine transport
GO:0015808 - L-alanine transport
GO:0015816 - glycine transport
GO:0042941 - D-alanine transport
GO:0042942 - D-serine transport
Note(s): Note(s): ...[more].
Reference(s): [1] Ghrist AC., et al., 1995
[2] Robbins JC., et al., 1973
External database links:  
DIP:
DIP-9359N
ECOCYC:
CYCA-MONOMER
ECOLIWIKI:
b4208
INTERPRO:
IPR002293
INTERPRO:
IPR004841
INTERPRO:
IPR004840
MINT:
MINT-1286142
PANTHER:
PTHR11785
PFAM:
PF00324
PRIDE:
P0AAE0
PRODB:
PRO_000022360
PROSITE:
PS00218
REFSEQ:
NP_418629
SMR:
P0AAE0
UNIPROT:
P0AAE0


Operon      
Name: cycA         
Operon arrangement:
Transcription unit        Promoter
cycA


Regulation by small RNA    
  Display Regulation
small RNA gcvB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_5065 4429770 forward nd [RS-EPT-CBR] [3]
  promoter TSS_5067 (cluster) 4429811 forward For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_5068 4430493 forward nd [RS-EPT-CBR] [3]
  promoter TSS_5069 4431082 forward nd [RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Ghrist AC., Stauffer GV., 1995, The Escherichia coli glycine transport system and its role in the regulation of the glycine cleavage enzyme system., Microbiology 141 ( Pt 1):133-40

 [2] Robbins JC., Oxender DL., 1973, Transport systems for alanine, serine, and glycine in Escherichia coli K-12., J Bacteriol 116(1):12-8

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB