RegulonDB RegulonDB 10.9: Gene Form
   

mgtA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

mgtA ridA mgtL Cis-reg; riboswitch

Gene      
Name: mgtA    Texpresso search in the literature
Synonym(s): ECK4237, EG12525, atmA, b4242, corB, mgt, mtg
Genome position(nucleotides): 4467625 --> 4470321 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.47
External database links:  
ASAP:
ABE-0013883
ECHOBASE:
EB2416
ECOLIHUB:
mgtA
MIM:
169600
OU-MICROARRAY:
b4242
STRING:
511145.b4242
COLOMBOS: mgtA


Product      
Name: Mg2+ importing P-type ATPase
Synonym(s): AtmA, CorB, Mgt, MgtA, Mtg
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 99.466
Isoelectric point: 5.817
Motif(s):
 
Type Positions Sequence
445 -> 450 FDFERR
696 -> 715 LKYIKMTASSNFGNVFSVLV
722 -> 888 FLPMLPLHLLIQNLLYDVSQVAIPFDNVDDEQIQKPQRWNPADLGRFMIFFGPISSIFDILTFCLMWWVFHANTPETQTLFQSGWFVVGLLSQTLIVHMIRTRRVPFIQSCASWPLMIMTVIVMIVGIALPFSPLASYLQLQALPLSYFPWLVAILAGYMTLTQLVK
48 -> 112 MPEEELWKTFDTHPEGLNQAEVESAREQHGENKLPAQQPSPWWVHLWVCYRNPFNILLTILGAIS
117 -> 137 DLFAAGVIALMVAISTLLNFI

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.3 - The P-type ATPase (P-ATPase) Superfamily
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0043231 - intracellular membrane-bounded organelle
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0005515 - protein binding
GO:0015662 - ion transmembrane transporter activity, phosphorylative mechanism
GO:0046872 - metal ion binding
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0015444 - magnesium transmembrane transporter activity, phosphorylative mechanism
GO:0019829 - ATPase-coupled cation transmembrane transporter activity
biological_process GO:0015693 - magnesium ion transport
GO:0071286 - cellular response to magnesium ion
GO:1903830 - magnesium ion transmembrane transport
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-48092N
ECOCYC:
MGTA-MONOMER
ECOLIWIKI:
b4242
INTERPRO:
IPR036412
INTERPRO:
IPR023299
INTERPRO:
IPR023298
INTERPRO:
IPR023214
INTERPRO:
IPR018303
INTERPRO:
IPR004014
INTERPRO:
IPR006068
INTERPRO:
IPR006415
INTERPRO:
IPR008250
INTERPRO:
IPR001757
MODBASE:
P0ABB8
PDB:
3GWI
PFAM:
PF00122
PFAM:
PF00702
PFAM:
PF00690
PFAM:
PF00689
PRIDE:
P0ABB8
PRINTS:
PR01836
PRODB:
PRO_000023227
PROSITE:
PS00154
REFSEQ:
NP_418663
SMART:
SM00831
SMR:
P0ABB8
UNIPROT:
P0ABB8


Operon      
Name: mgtLA         
Operon arrangement:
Transcription unit        Promoter
mgtA
mgtA


Transcriptional Regulation      
Display Regulation             
Activated by: PhoP


RNA cis-regulatory element    
   
Cis-reg; riboswitch Magnesium Sensor
   
   


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB