RegulonDB RegulonDB 10.8: Gene Form
   

opgB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

opgB lgoD yjjA terminator opgBp7 opgBp7 TSS_5156 TSS_5156 TSS_5155 TSS_5155

Gene      
Name: opgB    Texpresso search in the literature
Synonym(s): ECK4349, EG12591, b4359, mdoB, yjjO
Genome position(nucleotides): 4597150 <-- 4599441 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.01
External database links:  
ASAP:
ABE-0014297
CGSC:
18169
ECHOBASE:
EB2476
OU-MICROARRAY:
b4359
PortEco:
mdoB
STRING:
511145.b4359
COLOMBOS: opgB


Product      
Name: phosphoglycerol transferase I
Synonym(s): MdoB, OpgB, YjjO
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 85.494
Isoelectric point: 6.517
Motif(s):
 
Type Positions Sequence
108 -> 128 FGYSLLALLLALGSVDASPAF
26 -> 46 WWFAATLTVLGLFVVLNITLF
77 -> 97 ILPGIGIVLGLTAVFGALGWI
1 -> 21 MSELLSFALFLASVLIYAWKA
163 -> 446 NLVYIYGESLERTYFDNEAFPDLTPELGALKNEGLDFSHTQQLPGTDYTIAGMVASQCGIPLFAPFEGNASASVSSFFPQNICLGDILKNSGYQNYFVQGANLRFAGKDVFLKSHGFDHLYGSEELKSVVADPHYRNDWGFYDDTVLDEAWKKFEELSRSGQRFSLFTLTVDTHHPDGFISRTCNRKKYDFDGKPNQSFSAVSCSQENIATFINKIKASPWFKDTVIVVSSDHLAMNNTAWKYLNKQDRNNLFFVIRGDKPQQETLAVKRNTMDNGATVLDILG

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.1 - phospholipid
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.6 - osmoregulated periplasmic glucan
  5 - cell processes --> 5.5 - adaptations --> 5.5.1 - osmotic pressure
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0003824 - catalytic activity
GO:0016740 - transferase activity
GO:0004065 - arylsulfatase activity
GO:0008484 - sulfuric ester hydrolase activity
GO:0008960 - phosphatidylglycerol-membrane-oligosaccharide glycerophosphotransferase activity
biological_process GO:0009250 - glucan biosynthetic process
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-10175N
ECOCYC:
PGLYCEROLTRANSI-MONOMER
ECOLIWIKI:
b4359
INTERPRO:
IPR020881
INTERPRO:
IPR017850
INTERPRO:
IPR000917
MINT:
MINT-1305397
MODBASE:
P39401
PFAM:
PF00884
PRIDE:
P39401
PRODB:
PRO_000023177
REFSEQ:
NP_418779
SMR:
P39401
UNIPROT:
P39401


Operon      
Name: opgB         
Operon arrangement:
Transcription unit        Promoter
 


RNA cis-regulatory element    
Attenuation: Translational


Regulation by small RNA    
  Display Regulation
small RNA gcvB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_5155 4597417 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_5156 4599493 reverse nd [RS-EPT-CBR] [1]
  promoter opgBp7 4599494 reverse Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB