RegulonDB RegulonDB 10.9: Gene Form
   

yiaG gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yiaF yiaG cspA Fis Fis H-NS Fis H-NS H-NS Fis H-NS Fis H-NS ppGpp Cis-reg; thermoregulator terminator TSS_4161 TSS_4161 TSS_4160 TSS_4160 cspAp2 cspAp2 cspAp1 cspAp1 yiaGp yiaGp yiaFp yiaFp

Gene      
Name: yiaG    Texpresso search in the literature
Synonym(s): ECK3542, EG12624, b3555
Genome position(nucleotides): 3719478 --> 3719768 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
43.99
External database links:  
ASAP:
ABE-0011612
ECHOBASE:
EB2508
ECOLIHUB:
yiaG
OU-MICROARRAY:
b3555
STRING:
511145.b3555
COLOMBOS: yiaG


Product      
Name: putative DNA-binding transcriptional regulator YiaG
Synonym(s): YiaG
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 11.033
Isoelectric point: 8.507
Motif(s):
 
Type Positions Sequence
38 -> 91 IEQLRKGTGLKIDDFARVLGVSVAMVKEWESRRVKPSSAELKLMRLIQANPALS
49 -> 68 IDDFARVLGVSVAMVKEWES

 

Classification:
Multifun Terms (GenProtEC)  
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
Note(s): Note(s): ...[more].
Reference(s): [1] Paradis-Bleau C., et al., 2014
External database links:  
ECOCYC:
EG12624-MONOMER
ECOLIWIKI:
b3555
INTERPRO:
IPR001387
INTERPRO:
IPR010982
PFAM:
PF01381
PRIDE:
P0A9V5
PROSITE:
PS50943
REFSEQ:
NP_418011
SMART:
SM00530
UNIPROT:
P0A9V5


Operon      
Name: yiaG         
Operon arrangement:
Transcription unit        Promoter
yiaG


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4160 3719942 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4161 3720104 forward nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Paradis-Bleau C., Kritikos G., Orlova K., Typas A., Bernhardt TG., 2014, A genome-wide screen for bacterial envelope biogenesis mutants identifies a novel factor involved in cell wall precursor metabolism., PLoS Genet 10(1):e1004056

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB