RegulonDB RegulonDB 10.9: Gene Form
   

grxB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

mdtH grxB yceB Fur ppGpp anti-anti-terminator anti-terminator terminator terminator grxBp grxBp grxBp2 grxBp2 grxBp4 grxBp4 TSS_1337 (cluster) TSS_1337 (cluster) TSS_1336 TSS_1336 TSS_1335 TSS_1335

Gene      
Name: grxB    Texpresso search in the literature
Synonym(s): ECK1049, EG12688, b1064
Genome position(nucleotides): 1123407 <-- 1124054 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.07
Reference(s): [1] Vlamis-Gardikas A., et al., 1997
External database links:  
ASAP:
ABE-0003615
ECHOBASE:
EB2551
ECOLIHUB:
grxB
ENTREZ:
X92076
OU-MICROARRAY:
b1064
STRING:
511145.b1064
COLOMBOS: grxB


Product      
Name: reduced glutaredoxin 2
Synonym(s): GRX 2, GrxB
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 24.35
Isoelectric point: 8.185
Motif(s):
 
Type Positions Sequence
86 -> 214 IEEWLRKVNGYANKLLLPRFAKSAFDEFSTPAARKYFVDKKEASAGNFADLLAHSDGLIKNISDDLRALDKLIVKPNAVNGELSEDDIQLFPLLRNLTLVAGINWPSRVADYRDNMAKQTQINLLSSMA
3 -> 74 LYIYDHCPYCLKARMIFGLKNIPVELHVLLNDDAETPTRMVGQKQVPILQKDDSRYMPESMDIVHYVDKLDG
1 -> 77 MKLYIYDHCPYCLKARMIFGLKNIPVELHVLLNDDAETPTRMVGQKQVPILQKDDSRYMPESMDIVHYVDKLDGKPL
13 -> 13 L

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.15 - large molecule carriers --> 1.6.15.2 - thioredoxin, glutaredoxin
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0009055 - electron transfer activity
GO:0015038 - glutathione disulfide oxidoreductase activity
GO:0097573 - glutathione oxidoreductase activity
biological_process GO:0022900 - electron transport chain
GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
Evidence: [IDA] Inferred from direct assay
Reference(s): [2] Lundstrom-Ljung J., et al., 1999
[3] Sheng J., et al., 2007
[4] Shi J., et al., 1999
External database links:  
DIP:
DIP-48247N
ECOCYC:
GRXB-MONOMER
ECOLIWIKI:
b1064
INTERPRO:
IPR004045
INTERPRO:
IPR007494
INTERPRO:
IPR011767
INTERPRO:
IPR036249
INTERPRO:
IPR036282
INTERPRO:
IPR011901
MODBASE:
P0AC59
PDB:
4KX4
PDB:
4KSM
PDB:
1G7O
PFAM:
PF04399
PFAM:
PF13417
PRIDE:
P0AC59
PRODB:
PRO_000022841
PROSITE:
PS50404
PROSITE:
PS00195
REFSEQ:
NP_415582
SMR:
P0AC59
UNIPROT:
P0AC59


Operon      
Name: grxB         
Operon arrangement:
Transcription unit        Promoter
grxB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1335 1123108 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_1336 1123297 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_1337 (cluster) 1124081 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [5]
  promoter grxBp4 1124083 reverse Similarity to the consensus
Read more >
[ICWHO] [6]
  promoter grxBp2 1124102 reverse Similarity to the consensus
Read more >
[ICWHO] [6]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Vlamis-Gardikas A., Aslund F., Spyrou G., Bergman T., Holmgren A., 1997, Cloning, overexpression, and characterization of glutaredoxin 2, an atypical glutaredoxin from Escherichia coli., J Biol Chem 272(17):11236-43

 [2] Lundstrom-Ljung J., Vlamis-Gardikas A., Aslund F., Holmgren A., 1999, Reactivity of glutaredoxins 1, 2 and 3 from Escherichia coli and protein disulfide isomerase towards glutathionyl-mixed disulfides in ribonuclease A., FEBS Lett 443(2):85-8

 [3] Sheng J., Ye J., Rosen BP., 2007, Crystallization and preliminary X-ray crystallographic analysis of Escherichia coliglutaredoxin 2 in complex with glutathione and of a cysteine-less variant without glutathione., Acta Crystallogr Sect F Struct Biol Cryst Commun 63(Pt 4):280-2

 [4] Shi J., Vlamis-Gardikas A., Aslund F., Holmgren A., Rosen BP., 1999, Reactivity of glutaredoxins 1, 2, and 3 from Escherichia coli shows that glutaredoxin 2 is the primary hydrogen donor to ArsC-catalyzed arsenate reduction., J Biol Chem 274(51):36039-42

 [5] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [6] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB