RegulonDB RegulonDB 10.9: Gene Form
   

yceK gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

opgH msyB yceK opgG terminator anti-terminator anti-anti-terminator TSS_1330 TSS_1330

Gene      
Name: yceK    Texpresso search in the literature
Synonym(s): ECK1036, EG12689, b1050
Genome position(nucleotides): 1113579 --> 1113806 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.44
External database links:  
ASAP:
ABE-0003565
ECHOBASE:
EB2552
ECOLIHUB:
yceK
OU-MICROARRAY:
b1050
STRING:
511145.b1050
COLOMBOS: yceK


Product      
Name: DUF1375 domain-containing lipoprotein YceK
Synonym(s): YceK
Sequence: Get amino acid sequence Fasta Format
Cellular location: outer membrane
Molecular weight: 8.443
Isoelectric point: 6.211
Motif(s):
 
Type Positions Sequence
49 -> 69 VTILDLPFSLVFDTLLLPIDI
1 -> 21 MRLIVVSIMVTLLSGCGSIIS
22 -> 75 RTIPGQGHGNQYYPGVQWDVRDSAWRYVTILDLPFSLVFDTLLLPIDIHHGPYE

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0031246 - intrinsic component of periplasmic side of cell outer membrane
biological_process GO:0006974 - cellular response to DNA damage stimulus
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG12689-MONOMER
ECOLIWIKI:
b1050
INTERPRO:
IPR010780
PFAM:
PF07119
PRIDE:
P0AB31
REFSEQ:
NP_415568
UNIPROT:
P0AB31


Operon      
Name: yceK         
Operon arrangement:
Transcription unit        Promoter
yceK


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1330 1111377 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB