RegulonDB RegulonDB 10.9: Gene Form
   

rarA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rarA serS lolA TSS_1091 TSS_1091 TSS_1090 TSS_1090 TSS_1089 TSS_1089 TSS_1088 (cluster) TSS_1088 (cluster) TSS_1087 TSS_1087 TSS_1086 TSS_1086 TSS_1085 TSS_1085 serSp serSp TSS_1083 TSS_1083 TSS_1082 TSS_1082 TSS_1081 TSS_1081

Gene      
Name: rarA    Texpresso search in the literature
Synonym(s): ECK0883, EG12690, b0892, mgsA, ycaJ
Genome position(nucleotides): 937994 --> 939337 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.57
External database links:  
ASAP:
ABE-0003034
ECHOBASE:
EB2553
ECOLIHUB:
rarA
OU-MICROARRAY:
b0892
STRING:
511145.b0892
COLOMBOS: rarA


Product      
Name: replication-associated recombination protein A
Synonym(s): MgsA, RarA, YcaJ
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 49.626
Isoelectric point: 6.338
Motif(s):
 
Type Positions Sequence
57 -> 64 GPPGTGKT
268 -> 434 GSAPDAALYWYARIITAGGDPLYVARRCLAIASEDVGNADPRAMQVAIAAWDCFTRVGPAEGERAIAQAIVYLACAPKSNAVYTAFKAALADARERPDYDVPVHLRNAPTKLMKEMGYGQEYRYAHDEANAYAAGEVYFPPEIAQTRYYFPTNRGLEGKIGEKLAWL
53 -> 159 MILWGPPGTGKTTLAEVIARYANADVERISAVTSGVKEIREAIERARQNRNAGRRTILFVDEVHRFNKSQQDAFLPHIEDGTITFIGATTENPSFELNSALLSRARV
156 -> 156 R
188 -> 267 QDIVLPDETRRAIAELVNGDARRALNTLEMMADMAEVDDSGKRVLKPELLTEIAGERSARFDNKGDRFYDLISALHKSVR

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.1 - DNA related --> 2.1.1 - DNA replication
  2 - information transfer --> 2.1 - DNA related --> 2.1.3 - DNA recombination
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0030894 - replisome
molecular_function GO:0003677 - DNA binding
GO:0005515 - protein binding
GO:0008047 - enzyme activator activity
GO:0008094 - DNA-dependent ATPase activity
GO:0016887 - ATPase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0042802 - identical protein binding
GO:0017116 - single-stranded DNA helicase activity
biological_process GO:0006260 - DNA replication
GO:0006261 - DNA-dependent DNA replication
GO:0006310 - DNA recombination
GO:0032508 - DNA duplex unwinding
GO:0006282 - regulation of DNA repair
GO:0043085 - positive regulation of catalytic activity
GO:0051289 - protein homotetramerization
External database links:  
DIP:
DIP-48151N
ECOCYC:
EG12690-MONOMER
ECOLIWIKI:
b0892
INTERPRO:
IPR003593
INTERPRO:
IPR032423
INTERPRO:
IPR003959
INTERPRO:
IPR008921
INTERPRO:
IPR021886
INTERPRO:
IPR027417
MODBASE:
P0AAZ4
PDB:
3PVS
PFAM:
PF16193
PFAM:
PF12002
PFAM:
PF00004
PRIDE:
P0AAZ4
PRODB:
PRO_000023678
REFSEQ:
NP_415412
SMART:
SM00382
SMR:
P0AAZ4
UNIPROT:
P0AAZ4


Operon      
Name: lolA-rarA         
Operon arrangement:
Transcription unit        Promoter
lolA-rarA


Transcriptional Regulation      
Display Regulation             
Activated by: RcsB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1081 937877 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1082 937932 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1083 939353 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1085 939422 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1086 939441 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1087 939732 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1088 (cluster) 939778 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_1089 939783 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1090 940085 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1091 940406 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB