RegulonDB RegulonDB 10.8: Gene Form
   

yccJ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

agp wrbA yccJ

Gene      
Name: yccJ    Texpresso search in the literature
Synonym(s): ECK0994, EG12703, b1003
Genome position(nucleotides): 1066864 <-- 1067091 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
46.93
External database links:  
ASAP:
ABE-0003390
ECHOBASE:
EB2565
OU-MICROARRAY:
b1003
PortEco:
yccJ
STRING:
511145.b1003
COLOMBOS: yccJ


Product      
Name: PF13993 family protein YccJ
Synonym(s): YccJ
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 8.524
Isoelectric point: 4.406
Motif(s):
 
Type Positions Sequence
9 -> 75 HHVGEWASLRNTSPEIAEAIFEVAGYDEKMAEKIWEEGSDEVLVKAFAKTDKDSLFWGEQTIERKNV
2 -> 75 PTQEAKAHHVGEWASLRNTSPEIAEAIFEVAGYDEKMAEKIWEEGSDEVLVKAFAKTDKDSLFWGEQTIERKNV

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-47912N
ECOCYC:
EG12703-MONOMER
ECOLIWIKI:
b1003
INTERPRO:
IPR025600
PFAM:
PF13993
PRIDE:
P0AB14
REFSEQ:
NP_415523
SMR:
P0AB14
UNIPROT:
P0AB14


Operon      
Name: wrbA-yccJ         
Operon arrangement:
Transcription unit        Promoter
wrbA-yccJ


Transcriptional Regulation      
Display Regulation             
Activated by: CsgD


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB