RegulonDB RegulonDB 10.10: Gene Form
   

yggM gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

hemW ansB yggM rdgB terminator yggMp1 yggMp1 yggMp4 yggMp4 yggMp3 yggMp3

Gene      
Name: yggM    Texpresso search in the literature
Synonym(s): ECK2951, EG12704, b2956
Genome position(nucleotides): 3098558 <-- 3099565 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
44.54
External database links:  
ASAP:
ABE-0009697
ECHOBASE:
EB2566
ECOLIHUB:
yggM
OU-MICROARRAY:
b2956
STRING:
511145.b2956
COLOMBOS: yggM


Product      
Name: DUF1202 domain-containing protein YggM
Synonym(s): YggM
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space
Molecular weight: 38.459
Isoelectric point: 8.551
Motif(s):
 
Type Positions Sequence
14 -> 320 LMTGNAWADGEPPTENILKDQFKKQYHGILKLDAITLKNLDAKGNQATWSAEGDVSSSDDLYTWVGQLADYELLEQTWTKDKPVKFSAMLTSKGTPASGWSVNFYSFQAAASDRGRVVDDIKTNNKYLIVNSEDFNYRFSQLESALNTQKNSIPALEKEVKALDKQMVAAQKAADAYWGKDANGKQMTREDAFKKIHQQRDEFNKQNDSEAFAVKYDKEVYQPAIAACHKQSEECYEVPIQQKRDFDINEQRRQTFLQSQKLSRKLQDDWVTLEKGQYPLTMKVSEINSKKVAILMKIDDINQANER

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0030288 - outer membrane-bounded periplasmic space
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG12704-MONOMER
ECOLIWIKI:
b2956
INTERPRO:
IPR009592
PFAM:
PF06717
PRIDE:
P46142
REFSEQ:
NP_417431
UNIPROT:
P46142


Operon      
Name: yggM         
Operon arrangement:
Transcription unit        Promoter
yggM


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yggMp3 3099593 reverse nd [ICWHO] [1]
  promoter yggMp4 3099595 reverse nd [ICWHO] [1]
  promoter yggMp1 3099757 reverse nd [ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB