RegulonDB RegulonDB 10.9: Gene Form
   

dxr gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

dxr uppS frr cdsAp2 cdsAp2 cdsAp3 cdsAp3 TSS_337 TSS_337 TSS_336 TSS_336 TSS_335 (cluster) TSS_335 (cluster) TSS_334 TSS_334 ispUp2 ispUp2 ispUp1 ispUp1 TSS_333 TSS_333 dxrp1 dxrp1 dxrp5 dxrp5 dxrp4 dxrp4 dxrp3 dxrp3 TSS_332 TSS_332

Gene      
Name: dxr    Texpresso search in the literature
Synonym(s): ECK0172, EG12715, b0173, ispC, yaeM
Genome position(nucleotides): 193521 --> 194717 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.63
External database links:  
ASAP:
ABE-0000592
ECHOBASE:
EB2575
ECOLIHUB:
dxr
OU-MICROARRAY:
b0173
STRING:
511145.b0173
COLOMBOS: dxr


Product      
Name: 1-deoxy-D-xylulose 5-phosphate reductoisomerase
Synonym(s): Dxr, IspC, YaeM
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 43.388
Isoelectric point: 5.881
Motif(s):
 
Type Positions Sequence
222 -> 228 SATMMNK
231 -> 231 E
146 -> 239 LLPVDSEHNAIFQSLPQPIQHNLGYADLEQNGVVSILLTGSGGPFRETPLRDLATMTPDQACRHPNWSMGRKISVDSATMMNKGLEYIEARWLF
4 -> 132 LTILGSTGSIGCSTLDVVRHNPEHFRVVALVAGKNVTRMVEQCLEFSPRYAVMDDEASAKLLKTMLQQQGSRTEVLSGQQAACDMAALEDVDQVMAAIVGAAGLLPTLAAIRAGKTILLANKESLVTCG
7 -> 36 LGSTGSIGCSTLDVVRHNPEHFRVVALVAG

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.3 - cofactors, small molecule carriers --> 1.5.3.11 - menaquinone, ubiquinone
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0046872 - metal ion binding
GO:0016491 - oxidoreductase activity
GO:0030604 - 1-deoxy-D-xylulose-5-phosphate reductoisomerase activity
GO:0030145 - manganese ion binding
GO:0042802 - identical protein binding
GO:0070402 - NADPH binding
biological_process GO:0008299 - isoprenoid biosynthetic process
GO:0016114 - terpenoid biosynthetic process
GO:0019288 - isopentenyl diphosphate biosynthetic process, methylerythritol 4-phosphate pathway
GO:0055114 - oxidation-reduction process
GO:0051484 - isopentenyl diphosphate biosynthetic process, methylerythritol 4-phosphate pathway involved in terpenoid biosynthetic process
External database links:  
DIP:
DIP-9484N
ECOCYC:
DXPREDISOM-MONOMER
ECOLIWIKI:
b0173
INTERPRO:
IPR003821
INTERPRO:
IPR036169
INTERPRO:
IPR036291
INTERPRO:
IPR013512
INTERPRO:
IPR013644
INTERPRO:
IPR026877
MODBASE:
P45568
PANTHER:
PTHR30525
PDB:
1K5H
PDB:
3R0I
PDB:
3ANN
PDB:
3ANM
PDB:
1JVS
PDB:
1ONN
PDB:
1ONO
PDB:
1ONP
PDB:
1Q0H
PDB:
1Q0L
PDB:
1Q0Q
PDB:
1T1R
PDB:
1T1S
PDB:
2EGH
PDB:
3ANL
PFAM:
PF02670
PFAM:
PF08436
PFAM:
PF13288
PRIDE:
P45568
PRODB:
PRO_000022494
REFSEQ:
NP_414715
SMR:
P45568
UNIPROT:
P45568


Operon      
Name: dxr-uppS-cdsA         
Operon arrangement:
Transcription unit        Promoter
uppS-cdsA
uppS-cdsA
cdsA
dxr-uppS-cdsA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_332 192941 forward nd [RS-EPT-CBR] [1]
  promoter dxrp3 193335 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter dxrp4 193338 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter dxrp5 193411 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter dxrp1 193471 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_333 194269 forward nd [RS-EPT-CBR] [1]
  promoter TSS_334 195472 forward nd [RS-EPT-CBR] [1]
  promoter TSS_335 (cluster) 195478 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_336 195482 forward nd [RS-EPT-CBR] [1]
  promoter TSS_337 195485 forward nd [RS-EPT-CBR] [1]
  promoter cdsAp3 195555 forward Similarity to the consensus
Read more >
[ICWHO], [RS-EPT-CBR] [1], [2]
  promoter cdsAp2 195561 forward Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB