RegulonDB RegulonDB 10.9: Gene Form
   

kbaY gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

agaS kbaY agaB

Gene      
Name: kbaY    Texpresso search in the literature
Synonym(s): ECK3125, EG12768, agaY, b3137, kba, yraC
Genome position(nucleotides): 3283143 --> 3284003 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.03
External database links:  
ASAP:
ABE-0010307
CGSC:
592
ECHOBASE:
EB2621
ECOLIHUB:
kbaY
OU-MICROARRAY:
b3137
STRING:
511145.b3137
COLOMBOS: kbaY


Product      
Name: tagatose-1,6-bisphosphate aldolase 1
Synonym(s): AgaY, Kba, KbaY, YraC
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 31.294
Isoelectric point: 5.359
Motif(s):
 
Type Positions Sequence
5 -> 283 STKYLLQDAQANGYAVPAFNIHNAETIQAILEVCSEMRSPVILAGTPGTFKHIALEEIYALCSAYSTTYNMPLALHLDHHESLDDIRRKVHAGVRSAMIDGSHFPFAENVKLVKSVVDFCHSQDCSVEAELGRLGGVEDDMSVDAESAFLTDPQEAKRFVELTGVDSLAVAIGTAHGLYSKTPKIDFQRLAEIREVVDVPLVLHGASDVPDEFVRRTIELGVTKVNVATELKIAFAGAVKAWFAENPQGNDPRYYMRVGMDAMKEVVRNKINVCGSANR
209 -> 211 GAS
230 -> 233 NVAT

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0032991 - protein-containing complex
molecular_function GO:0003824 - catalytic activity
GO:0005515 - protein binding
GO:0016829 - lyase activity
GO:0046872 - metal ion binding
GO:0016832 - aldehyde-lyase activity
GO:0008270 - zinc ion binding
GO:0009025 - tagatose-bisphosphate aldolase activity
GO:0042802 - identical protein binding
biological_process GO:0005975 - carbohydrate metabolic process
GO:0051289 - protein homotetramerization
GO:2001059 - D-tagatose 6-phosphate catabolic process
External database links:  
DIP:
DIP-47961N
ECOCYC:
TAGAALDOL1-MONOMER
ECOLIWIKI:
b3137
INTERPRO:
IPR000771
INTERPRO:
IPR023788
INTERPRO:
IPR013785
INTERPRO:
IPR011288
MODBASE:
P0AB74
PDB:
1GVF
PFAM:
PF01116
PRIDE:
P0AB74
PRODB:
PRO_000023044
PROSITE:
PS00602
PROSITE:
PS00806
REFSEQ:
NP_417606
SMR:
P0AB74
UNIPROT:
P0AB74


Operon      
Name: agaS-kbaY-agaBCDI         
Operon arrangement:
Transcription unit        Promoter
agaSYBCDI


Transcriptional Regulation      
Display Regulation             
Repressed by: AgaR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB