RegulonDB RegulonDB 10.9: Gene Form
   

agaC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

agaC agaD agaI agaB

Gene      
Name: agaC    Texpresso search in the literature
Synonym(s): ECK3127, EG12770, b3139, yraE
Genome position(nucleotides): 3284685 --> 3285488 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.37
External database links:  
ASAP:
ABE-0010312
ECHOBASE:
EB2623
ECOLIHUB:
agaC
OU-MICROARRAY:
b3139
STRING:
511145.b3139
COLOMBOS: agaC


Product      
Name: galactosamine-specific PTS enzyme IIC component
Synonym(s): AgaC, YraE
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 28.645
Isoelectric point: 5.143
Motif(s):
 
Type Positions Sequence
67 -> 87 AGGVQPPNPIMAGLMTTVIAW
7 -> 238 LQGLSLAALVFVLGIDFWLEALFLFRPIIVCTLTGAILGDIQTGLITGGLTELAFAGLTPAGGVQPPNPIMAGLMTTVIAWSTGVDAKTAIGLGLPFSLLMQYVILFFYSAFSLFMTKADKCAKEADTAAFSRLNWTTMLIVASAYAVIAFLCTYLAQGAMQALVKAMPAWLTHGFEVAGGILPAVGFGLLLRVMFKAQYIPYLIAGFLFVCYIQVSNLLPVAVLGAGFAVY
178 -> 198 LTHGFEVAGGILPAVGFGLLL
1 -> 237 MHEITLLQGLSLAALVFVLGIDFWLEALFLFRPIIVCTLTGAILGDIQTGLITGGLTELAFAGLTPAGGVQPPNPIMAGLMTTVIAWSTGVDAKTAIGLGLPFSLLMQYVILFFYSAFSLFMTKADKCAKEADTAAFSRLNWTTMLIVASAYAVIAFLCTYLAQGAMQALVKAMPAWLTHGFEVAGGILPAVGFGLLLRVMFKAQYIPYLIAGFLFVCYIQVSNLLPVAVLGAGFAV
34 -> 54 IIVCTLTGAILGDIQTGLITG

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.4 - Group Translocators --> 4.4.A - Phosphotransferase Systems (PEP-dependent PTS)
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
biological_process GO:0008643 - carbohydrate transport
GO:0009401 - phosphoenolpyruvate-dependent sugar phosphotransferase system
Note(s): Note(s): ...[more].
Reference(s): [1] Reizer J., et al., 1996
External database links:  
ECOCYC:
AGAC-MONOMER
ECOLIWIKI:
b3139
INTERPRO:
IPR004700
PFAM:
PF03609
PRIDE:
P42910
PRODB:
PRO_000022066
PROSITE:
PS51106
REFSEQ:
NP_417608
UNIPROT:
P42910


Operon      
Name: agaS-kbaY-agaBCDI         
Operon arrangement:
Transcription unit        Promoter
agaSYBCDI


Transcriptional Regulation      
Display Regulation             
Repressed by: AgaR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Reizer J., Ramseier TM., Reizer A., Charbit A., Saier MH., 1996, Novel phosphotransferase genes revealed by bacterial genome sequencing: a gene cluster encoding a putative N-acetylgalactosamine metabolic pathway in Escherichia coli., Microbiology 142 ( Pt 2):231-50


RegulonDB