RegulonDB RegulonDB 10.9: Gene Form
   

mlaF gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yrbG mlaF mlaE MarA terminator anti-terminator TSS_3505 TSS_3505 yrbGp yrbGp mlaFp1 mlaFp1 mlaFp2 mlaFp2 mlaFp3 mlaFp3 TSS_3504 TSS_3504

Gene      
Name: mlaF    Texpresso search in the literature
Synonym(s): ECK3184, EG12801, b3195, yrbF
Genome position(nucleotides): 3339256 <-- 3340065 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.57
External database links:  
ASAP:
ABE-0010498
ECHOBASE:
EB2653
ECOLIHUB:
mlaF
OU-MICROARRAY:
b3195
STRING:
511145.b3195
COLOMBOS: mlaF


Product      
Name: intermembrane phospholipid transport system, ATP binding subunit MlaF
Synonym(s): MlaF, YrbF
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 29.097
Isoelectric point: 6.634
Motif(s):
 
Type Positions Sequence
47 -> 47 K
9 -> 245 VDMRDVSFTRGNRCIFDNISLTVPRGKITAIMGPSGIGKTTLLRLIGGQIAPDHGEILFDGENIPAMSRSRLYTVRKRMSMLFQSGALFTDMNVFDNVAYPLREHTQLPAPLLHSTVMMKLEAVGLRGAAKLMPSELSGGMARRAALARAIALEPDLIMFDEPFVGQDPITMGVLVKLISELNSALGVTCVVVSHDVPEVLSIADHAWILADKKIVAHGSAQALQANPDPRVRQFLD
145 -> 148 LSGG
165 -> 171 LIMFDEP
25 -> 172 DNISLTVPRGKITAIMGPSGIGKTTLLRLIGGQIAPDHGEILFDGENIPAMSRSRLYTVRKRMSMLFQSGALFTDMNVFDNVAYPLREHTQLPAPLLHSTVMMKLEAVGLRGAAKLMPSELSGGMARRAALARAIALEPDLIMFDEPF

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.a - ABC superfamily ATP binding cytoplasmic component
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0032991 - protein-containing complex
molecular_function GO:0120014 - phospholipid transfer activity
GO:0005515 - protein binding
GO:0016887 - ATPase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
biological_process GO:0120010 - intermembrane phospholipid transfer
GO:0015914 - phospholipid transport
Note(s): Note(s): ...[more].
Reference(s): [1] Ekiert DC., et al., 2017
[2] Hughes GW., et al., 2019
External database links:  
DIP:
DIP-35865N
ECOCYC:
YRBF-MONOMER
ECOLIWIKI:
b3195
INTERPRO:
IPR003593
INTERPRO:
IPR030296
INTERPRO:
IPR027417
INTERPRO:
IPR017871
INTERPRO:
IPR003439
MODBASE:
P63386
PANTHER:
PTHR43023:SF3
PDB:
6XGY
PFAM:
PF00005
PRIDE:
P63386
PROSITE:
PS00211
PROSITE:
PS50893
REFSEQ:
NP_417662
SMART:
SM00382
SMR:
P63386
UNIPROT:
P63386


Operon      
Name: mlaFEDCB         
Operon arrangement:
Transcription unit        Promoter
mlaFEDCB
mlaFEDCB
mlaFEDCB


Transcriptional Regulation      
Display Regulation             
Activated by: MarA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3504 3338787 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_3505 3341124 forward nd [RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Ekiert DC., Bhabha G., Isom GL., Greenan G., Ovchinnikov S., Henderson IR., Cox JS., Vale RD., 2017, Architectures of Lipid Transport Systems for the Bacterial Outer Membrane., Cell 169(2):273-285.e17

 [2] Hughes GW., Hall SCL., Laxton CS., Sridhar P., Mahadi AH., Hatton C., Piggot TJ., Wotherspoon PJ., Leney AC., Ward DG., Jamshad M., Spana V., Cadby IT., Harding C., Isom GL., Bryant JA., Parr RJ., Yakub Y., Jeeves M., Huber D., Henderson IR., Clifton LA., Lovering AL., Knowles TJ., 2019, Evidence for phospholipid export from the bacterial inner membrane by the Mla ABC transport system., Nat Microbiol 4(10):1692-1705

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB