RegulonDB RegulonDB 10.9: Gene Form
   

ybaM gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

mscK priC ybaM ybaNp1 ybaNp1 ybaMp3 ybaMp3 TSS_631 TSS_631 TSS_630 TSS_630 TSS_629 TSS_629

Gene      
Name: ybaM    Texpresso search in the literature
Synonym(s): ECK0460, EG12830, b0466
Genome position(nucleotides): 490110 <-- 490271 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.15
External database links:  
ASAP:
ABE-0001616
ECHOBASE:
EB2679
ECOLIHUB:
ybaM
OU-MICROARRAY:
b0466
STRING:
511145.b0466
COLOMBOS: ybaM


Product      
Name: DUF2496 domain-containing protein YbaM
Synonym(s): YbaM, small protein involved in the cell envelope stress response
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 6.025
Isoelectric point: 4.228
Motif(s):
 
Type Positions Sequence
2 -> 44 SLENAPDDVKLAVDLIVLLEENQIPASTVLRALDIVKRDYEKK

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.5 - adaptations
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
biological_process GO:0036460 - cellular response to cell envelope stress
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
Reference(s): [1] Hobbs EC., et al., 2010
External database links:  
ECOCYC:
EG12830-MONOMER
ECOLIWIKI:
b0466
INTERPRO:
IPR019630
PFAM:
PF10689
PRIDE:
P45807
REFSEQ:
NP_414999
SMR:
P45807
UNIPROT:
P45807


Operon      
Name: priC-ybaM         
Operon arrangement:
Transcription unit        Promoter
priC-ybaM


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_629 487911 forward nd [RS-EPT-CBR] [2]
  promoter TSS_630 488317 forward nd [RS-EPT-CBR] [2]
  promoter TSS_631 489636 forward nd [RS-EPT-CBR] [2]
  promoter ybaMp3 490324 reverse Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter ybaNp1 490718 forward Similarity to the consensus
Read more >
[ICWHO] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Hobbs EC., Astarita JL., Storz G., 2010, Small RNAs and small proteins involved in resistance to cell envelope stress and acid shock in Escherichia coli: analysis of a bar-coded mutant collection., J Bacteriol 192(1):59-67

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB