RegulonDB RegulonDB 10.8: Gene Form
   

ybaN gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

apt priC ybaN aptp aptp ybaNp9 ybaNp9 ybaNp6 ybaNp6 ybaNp8 ybaNp8 ybaNp1 ybaNp1 ybaMp3 ybaMp3

Gene      
Name: ybaN    Texpresso search in the literature
Synonym(s): ECK0462, EG12843, b0468
Genome position(nucleotides): 490882 --> 491259 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.12
External database links:  
ASAP:
ABE-0001625
ECHOBASE:
EB2692
OU-MICROARRAY:
b0468
PortEco:
ybaN
STRING:
511145.b0468
COLOMBOS: ybaN


Product      
Name: DUF454 domain-containing inner membrane protein YbaN
Synonym(s): YbaN
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 14.77
Isoelectric point: 11.491
Motif(s):
 
Type Positions Sequence
96 -> 118 WVRIMLLVILACLLFYMWRIPVI
7 -> 26 IIIGWLAVVLGTLGVVLPVL
70 -> 70 P
3 -> 116 RIILIIIGWLAVVLGTLGVVLPVLPTTPFILLAAWCFARSSPRFHAWLLYRSWFGSYLRFWQKHHAMPRGVKPRAILLILLTFAISLWFVQMPWVRIMLLVILACLLFYMWRIP
75 -> 92 PRAILLILLTFAISLWFV

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
Note(s): Note(s): ...[more].
Reference(s): [1] Chen CS., et al., 2009
External database links:  
ECOCYC:
EG12843-MONOMER
ECOLIWIKI:
b0468
INTERPRO:
IPR007401
PANTHER:
PTHR35813
PFAM:
PF04304
PRIDE:
P0AAR5
REFSEQ:
NP_415001
UNIPROT:
P0AAR5


Operon      
Name: ybaN         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ybaMp3 490324 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter ybaNp1 490718 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter ybaNp8 490857 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter ybaNp6 490873 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter ybaNp9 490879 forward Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Chen CS., Sullivan S., Anderson T., Tan AC., Alex PJ., Brant SR., Cuffari C., Bayless TM., Talor MV., Burek CL., Wang H., Li R., Datta LW., Wu Y., Winslow RL., Zhu H., Li X., 2009, Identification of novel serological biomarkers for inflammatory bowel disease using Escherichia coli proteome chip., Mol Cell Proteomics 8(8):1765-76

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB