RegulonDB RegulonDB 10.9: Gene Form
   

ybeL gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

leuS ybeQ ybeL TSS_776 TSS_776 TSS_775 (cluster) TSS_775 (cluster) ybeLp ybeLp TSS_773 TSS_773 TSS_772 TSS_772 TSS_771 TSS_771 TSS_770 TSS_770 TSS_769 TSS_769 TSS_768 TSS_768 TSS_767 TSS_767 TSS_766 (cluster) TSS_766 (cluster) TSS_765 TSS_765 TSS_764 TSS_764

Gene      
Name: ybeL    Texpresso search in the literature
Synonym(s): ECK0636, EG12851, b0643
Genome position(nucleotides): 675018 --> 675500 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.59
External database links:  
ASAP:
ABE-0002199
ECHOBASE:
EB2696
ECOLIHUB:
ybeL
OU-MICROARRAY:
b0643
STRING:
511145.b0643
COLOMBOS: ybeL


Product      
Name: DUF1451 domain-containing protein YbeL
Synonym(s): YbeL
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 18.797
Isoelectric point: 4.863
Motif(s):
 
Type Positions Sequence
14 -> 157 SLSERLRNGERDIDALVEQARERVIKTGELTRTEVDELTRAVRRDLEEFAMSYEESLKEESDSVFMRVIKESLWQELADITDKTQLEWREVFQDLNHHGVYHSGEVVGLGNLVCEKCHFHLPIYTPEVLTLCPKCGHDQFQRRP

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG12851-MONOMER
ECOLIWIKI:
b0643
INTERPRO:
IPR009912
PFAM:
PF07295
PRIDE:
P0AAT9
REFSEQ:
NP_415176
SMR:
P0AAT9
UNIPROT:
P0AAT9


Operon      
Name: ybeL         
Operon arrangement:
Transcription unit        Promoter
ybeL


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_764 673731 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_765 673832 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_766 (cluster) 674050 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_767 674222 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_768 674835 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_769 674845 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_770 674922 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_771 674937 forward nd [RS-EPT-CBR] [1]
  promoter TSS_772 674941 forward nd [RS-EPT-CBR] [1]
  promoter TSS_773 674976 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_775 (cluster) 674996 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_776 675001 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB